(data stored in ACNUC7421 zone)

EMBL: CP001720.PE568

CP001720.PE568       Location/Qualifiers
FT   CDS_pept        640033..642312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0613"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: gbm:Gbem_2944 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61533"
FT                   /db_xref="GOA:C8W0W4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACV61533.1"
FT                   /translation="MKWFYNMKVSAKLFVAFILVAIITGIVGMIGIVNIREINEKDTQL
FT                   YKNMIVPIAELSQITNSFQRMRVSLRDIILAQTPDDIAVNNNKIMDRLAEIDKYSADFE
FT                   KTMISQEIKDAFSQFKNSTKAYHAELEVIVELAKANKDAEATAYMYGSQAQKASQVEED
FT                   AIAKLVNLKEKAARETSYNNSELAVNAEKMMIIFIILSILISLSLGLFISNIISRPVRK
FT                   LSEAAGKLAIGDINVTVEAVSKDEIGNLALAFGKMVENIREQANNAEKVAQGDLSVEIK
FT                   AKSDSDVLAKSMKLVVEELRHLVDDTVMLTQAAVQGKLQTRADADKFSGGYKEIVEGVN
FT                   NILNAVIEPVKEASSVLQEMAKGNLKVSVNGNYRGDHAEIKDALNFTLSTVSGYINEIS
FT                   SVLTNMADGNLAVGISGEYLGDFIEIKNSLNSIVKSFNEILGDMNTASEQVATGSMQVS
FT                   DSSQALSQGSTEQASAIEELTVSMTEIAAQTKQNAVNASQASELALEVKNNAIKGNERM
FT                   REMLQAMDEINISSGNISKIIKVIDEIAFQTNILALNAAVEAARAGQHGKGFAVVAEEV
FT                   RNLAARSANAAKETTSMIEGSISKVESGTKIAKETAQALNSIVEGVTRAANLVGEIANA
FT                   SSEQATGIAQVNQGIEQVSMVVQTNSATAEESAAASEELSGQAEILKEMVSKFRLKKTG
FT                   SSFNNGGELNENFLRMLEEISESRKSSKAANRAEQEMDYALAQVASAGQTVKPKISLSD
FT                   REFDKY"
     atgaaatggt tttacaacat gaaagtcagc gctaagctgt ttgtggcatt tattcttgta        60
     gcgatcataa ccggaatagt aggtatgatt ggtatagtaa atataagaga gattaatgaa       120
     aaggataccc aactttataa gaacatgatt gtgccaattg ctgaattaag tcaaattaca       180
     aattcttttc aaagaatgag agtaagcctc cgtgatatta ttcttgccca aactcctgat       240
     gatattgcag tgaataataa taaaattatg gatagattgg ctgagattga taagtattcg       300
     gcagactttg agaaaacaat gatatcacag gaaataaagg atgcttttag ccaatttaag       360
     aactcaacca aagcatatca tgcggaactt gaagtaatag tagaactggc caaagctaat       420
     aaagatgccg aggctactgc ttatatgtat ggcagccagg cgcaaaaagc ctcccaggtt       480
     gaagaggatg ctattgcaaa actggttaat ttgaaagaaa aagcggcaag agaaacttca       540
     tataataatt ccgagcttgc agttaatgct gaaaaaatga tgattatatt tatcatatta       600
     agcatactga tctctttaag cctcggttta tttatttcaa atataatcag caggcctgtg       660
     agaaagcttt ctgaagctgc cggcaaactg gcaattggag atattaatgt cactgttgaa       720
     gctgtatcaa aagatgagat tggtaattta gccctggcat ttggcaaaat ggttgagaat       780
     atccgggagc aggcaaacaa tgcggaaaaa gttgctcagg gcgatctttc tgtagaaata       840
     aaggcaaaat cagacagtga tgtgctggcc aagagtatga aacttgttgt agaagaactg       900
     agacatctgg tggatgatac agtaatgctt acgcaggcgg ctgttcaagg caagctgcaa       960
     accagggccg atgcggataa attcagcggt ggctataagg aaatagttga aggtgtgaac      1020
     aatattctca acgcggtaat agagccggtg aaggaggctt cctcagtact ccaggagatg      1080
     gctaaaggaa atctgaaggt cagtgtgaac ggtaattaca ggggagatca cgcggagatt      1140
     aaggatgctc tgaatttcac tctttccact gtttccggtt atatcaacga aatatcttct      1200
     gttcttacca atatggccga tgggaacctg gcagtaggca tcagcggtga atatctgggt      1260
     gactttatag aaattaagaa ttcattgaac agcattgtca agtcttttaa tgaaatactg      1320
     ggagatatga atacagcttc agagcaggtg gctaccggtt caatgcaggt atctgattcc      1380
     agtcaggcat tatctcaggg ttctacagaa caggccagtg ccattgaaga gctgactgtc      1440
     tcaatgacag agattgctgc acagaccaaa caaaatgcgg ttaatgccag ccaagccagt      1500
     gagcttgctc tggaagttaa gaataatgca ataaaaggta atgagcggat gagggaaatg      1560
     ctgcaggcaa tggatgaaat aaatatatct tcagggaata tttccaaaat aattaaagtt      1620
     attgatgaaa ttgcctttca gaccaatatt cttgctttaa acgccgcggt ggaagctgcc      1680
     agggccggcc agcacgggaa agggtttgcc gttgtagctg aggaagtgag aaacctggct      1740
     gcaagaagtg ctaatgcggc caaggaaaca acttctatga ttgaaggttc gatcagcaag      1800
     gttgagagcg ggacaaagat tgctaaagag acagcacaag ccttaaacag tattgtggaa      1860
     ggcgtaacca gggcggctaa tcttgttggt gaaatcgcta atgcctccag tgaacaggct      1920
     actggaattg ctcaggtaaa tcagggtatt gagcaggtgt caatggtggt gcaaactaat      1980
     tcagctactg ccgaagagag tgcggctgcc agtgaggaat tatcaggcca ggcagaaatt      2040
     cttaaagaaa tggtttctaa attcaggttg aaaaaaaccg gttcatcttt taataatggg      2100
     ggtgagctta atgagaactt tttgagaatg ctggaagaaa tatctgaaag cagaaaatct      2160
     tctaaagcag ccaacagggc cgaacaggag atggattatg cattagctca ggttgcctcc      2220
     gccggacaga ctgtaaaacc caaaatttct ctcagtgaca gggagtttga caaatattaa      2280
//

If you have problems or comments...

PBIL Back to PBIL home page