(data stored in ACNUC7421 zone)

EMBL: CP001720.PE569

CP001720.PE569       Location/Qualifiers
FT   CDS_pept        642411..643238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0614"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: dal:Dalk_3925 MCP methyltransferase, CheR-
FT                   type; PFAM: MCP methyltransferase CheR-type; SMART: MCP
FT                   methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61534"
FT                   /db_xref="GOA:C8W0W5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W5"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACV61534.1"
FT                   /translation="MAQEGVNISEKEFSRLACFIKQHFGINLVQEKKLLVVSRLQNFLI
FT                   RNNFKSFSEYFDYVVADRTGNAVVTLLNKLTTNHTFFMREADHFDFFRNKVLPYLSQKV
FT                   KDKDLRIWSAGCSTGQESYTLSMIIDEYFGAEKKLWNTKVLATDISTIVLEKAKKGEYS
FT                   DEEICMIPRHRRFSYFIKNDNQRYCIVNEIKKEVIYRRFNLMDEVFPFKKKFQVIFCRN
FT                   VMIYFDRKTKQELVNKFYDFTEPGGYLFIGHSESLNQIETGFRYIRPAIYRKA"
     atggctcaag aaggggttaa tatatccgaa aaggaattca gccggctggc ctgttttatt        60
     aaacagcatt ttggaataaa tctggtgcaa gagaaaaaac tgttggtggt aagccggttg       120
     caaaactttt tgatacggaa caactttaaa agtttttccg aatactttga ttatgttgtt       180
     gcggacagaa caggtaatgc agtagtcact ctgctcaata aactgactac aaatcatact       240
     ttttttatgc gtgaagcaga tcactttgat tttttcagaa acaaggtttt gccttacctt       300
     tcacaaaagg ttaaggacaa ggatttaaga atctggagtg ccgggtgttc taccggtcag       360
     gaatcttata ctctttccat gattatagac gagtactttg gggcggaaaa aaaattatgg       420
     aacacaaaag ttctggccac agacatatct actattgttc tggaaaaggc gaaaaaaggt       480
     gaatactcgg atgaggaaat ttgcatgata cccaggcaca ggagatttag ctattttata       540
     aaaaatgata atcagaggta ttgtatagtt aatgaaataa agaaagaagt catttacaga       600
     aggtttaatc ttatggatga ggttttccct tttaaaaaaa agtttcaggt tattttctgt       660
     agaaatgtta tgatctactt tgatcgaaag accaagcagg agctggtgaa taagttttat       720
     gattttacag aaccgggagg ttatttgttc atcggtcatt cagaatcact caatcaaata       780
     gaaacaggtt ttaggtatat taggcctgcc atatatcgta aggcatag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page