(data stored in ACNUC7421 zone)

EMBL: CP001720.PE58

CP001720.PE58        Location/Qualifiers
FT   CDS_pept        65587..66549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0060"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; Peptidoglycan-binding LysM;
FT                   SMART: Peptidoglycan-binding LysM; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61023"
FT                   /db_xref="GOA:C8VVF7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACV61023.1"
FT                   /translation="MRLFGIYYHEMGIYIIMFKREGVSMEISGRKIKYAVSMLLVTSIF
FT                   AMGYPALARYDELIIPAGINNVVDIKSKGIKNEIYVVKSGDSLWKLSAMYGLTVEELMS
FT                   INGLPRDKDLILEGQKLRISAEKPVLHTVKKGETLISIAADYNSALSKLIEKNKISDIN
FT                   HLYEGQVLVVLPNEARNEQSSSLQQVSRNMPLMAFNWPVRGDISSVFGMRDGRPHQGVD
FT                   IAANEGESIKAARSGRVVFAGPRGTYGLAVILDHGRDVQTLYAHCSKILVSDGEDVEVG
FT                   QCIAEIGNTGRSTGPHLHFEVINRGVHYDPLLYLTRGYI"
     ttgagattat ttggtatata ttatcatgaa atgggtatat atataataat gtttaagaga        60
     gaaggagtta gtatggagat ttcgggtaga aaaataaagt atgctgtttc catgttatta       120
     gtaacatcaa tttttgctat gggttatccc gcattggctc gttatgatga actaattatt       180
     cctgccggaa ttaataatgt tgttgatata aaaagcaagg gtataaaaaa tgaaatatat       240
     gtggtaaaaa gcggtgatag cttgtggaag ttgtccgcca tgtatggtct aacggtagaa       300
     gaattgatgt ccataaacgg tttgcctcgt gataaggatt taattttaga agggcagaaa       360
     ttacgaattt ctgcggaaaa accggttttg cacacagtaa aaaaagggga aacactaatt       420
     tctatagcgg ccgattataa ctcggcattg agcaagttaa ttgagaaaaa taagatttcc       480
     gatatcaatc atttatacga aggccaggta ctggttgtat tgcccaatga agcgagaaac       540
     gagcaatcct catcattaca gcaggtttct cgtaatatgc ctttaatggc ctttaattgg       600
     ccggttcggg gagatataag ctccgtgttt ggtatgcgtg atgggcgtcc acaccagggg       660
     gtggatatag cggctaatga aggagagagc atcaaggctg ccagaagcgg cagggttgtt       720
     tttgccggac caaggggtac ttacggtttg gcggttattt tggatcacgg cagggatgtg       780
     caaacccttt atgcccactg ctcgaaaata ttggtgtctg atggcgaaga tgttgaagtt       840
     gggcagtgca tagctgaaat aggaaatacc ggccgttcca caggtcctca cttgcatttt       900
     gaagtgataa accggggagt acattatgat cctttacttt atctgactcg cggttatatt       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page