(data stored in ACNUC7421 zone)

EMBL: CP001720.PE60

CP001720.PE60        Location/Qualifiers
FT   CDS_pept        68055..68261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0062"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: ilo:IL2462 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61025"
FT                   /db_xref="GOA:C8VVF9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF9"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACV61025.1"
FT                   /translation="MLKSGIHPEYRTIKVKCVCGNEFNTGSVRKEDLRVEICSNCHPFY
FT                   TGTQRTIETGGRAERFRKKYGIS"
     gtgttgaaaa gcggtatcca tcctgagtac agaacaatta aggtgaagtg tgtttgcgga        60
     aatgagttta ataccggttc cgttcgcaaa gaagacctgc gggttgaaat ttgctcaaat       120
     tgccaccctt tctataccgg tacacagaga actattgaaa ccggcgggcg tgccgagcgt       180
     ttccggaaaa aatacggcat aagttag                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page