(data stored in ACNUC7421 zone)

EMBL: CP001720.PE61

CP001720.PE61        Location/Qualifiers
FT   CDS_pept        68532..69407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0063"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   gme:Gmet_0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61026"
FT                   /db_xref="GOA:C8VVG0"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG0"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ACV61026.1"
FT                   /translation="MKPAYTYGGQAVIEGVMMRGPATRAVAVRCPDETIVVDQKPVRDP
FT                   ARRFPFLKWPFLRGLVVLIDSLIIGIEALTYSASQAVGEEEELSTREIFFTVATALLLG
FT                   VLLFIVLPTAATHFFAAKVKGSIGQNLVEGVVRVGVFLIYVIAISFMKDIQRVFQYHGA
FT                   EHKVINAFEAGEELTVENVQKYSTFHPRCGTSFLLIVMVVSIVVFSLSGYKILWWRILS
FT                   RVILMPVVAGVSYELLKLSGKYYRTLWCRIMIAPGKWLQKLTTREPDNGQVEVAISALK
FT                   AVLKDGEASV"
     gtgaaacctg cttataccta tggcggtcag gccgtcatag agggagttat gatgagagga        60
     ccggcgacca gggctgttgc tgtgcgctgt cctgatgaga ctatagttgt agatcaaaag       120
     cctgtgcgcg atcctgcccg acgcttccct tttttgaaat ggccgtttct gcggggattg       180
     gtagttttaa ttgactcttt aattattggt attgaggcct taacatattc tgccagtcag       240
     gctgtgggag aggaagagga gctaagtacc agggaaatat ttttcacagt tgctacagca       300
     ttgctcctcg gagtattgtt gttcattgta ttgcctactg ccgcaacaca tttttttgca       360
     gccaaagtta aaggaagtat aggtcaaaac ttggttgagg gtgtagtcag agtaggggtt       420
     tttttaattt atgtaattgc tatttccttt atgaaagata ttcaaagagt cttccaatac       480
     catggtgcgg agcataaagt aattaatgct tttgaggcgg gggaagagct tactgtggag       540
     aatgtgcaaa aatattctac ctttcatccc cgttgtggaa ccagcttttt gctgattgta       600
     atggtggtaa gtatcgtagt tttctcttta tccggttata agatactatg gtggcggatt       660
     ttatccaggg ttatcttgat gccggtagtt gcaggagttt cttatgagtt gttgaagttg       720
     tctggaaagt attatcgtac tctctggtgc cgtatcatga ttgccccggg aaaatggctg       780
     cagaaactga ctacccggga accggataac ggtcaggttg aagtagctat atctgcgctt       840
     aaggcagttt taaaggatgg tgaggcgagt gtttga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page