(data stored in ACNUC7421 zone)

EMBL: CP001720.PE62

CP001720.PE62        Location/Qualifiers
FT   CDS_pept        69400..70467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0064"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   bsu:BSU37010 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61027"
FT                   /db_xref="GOA:C8VVG1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG1"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACV61027.1"
FT                   /translation="MFERLQKIEERYEELGDLMGDPEVMADHSRWQQYVKAHADMQDIV
FT                   NVYREYRQLDQEVSDARELLKDKLDEDFREMVELELEELSEKKEELVQKLKLLLLPKDP
FT                   NDDKNVILEVRAGTGGEEAALFAGDLFRMYTRYAEKQGWRTEVLDANYTDIGGFKEVVC
FT                   MIEGKGAYSRLKFESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEEVEIDINPNDLRI
FT                   DVFCSTGPGGQSVNTTQSAVRITHLPSGLVVSCQDEKSQHKNKDKAMRVLRARLKDLAE
FT                   SEQRSELASTRKSMVGSGDRSERIRTYNFPQNRITDHRIGLTTHRMPAVLMGEMDEIIE
FT                   ALITTDQADRLRSTE"
     gtgtttgaga gactgcagaa aattgaggaa cgttatgagg aattaggaga tttgatgggt        60
     gatccggaag ttatggccga ccattcccgc tggcagcaat atgttaaagc acatgccgat       120
     atgcaggata ttgtaaatgt ataccgcgag tatagacagt tggatcaaga agtatcagat       180
     gccagagaac tgttaaaaga taaattagac gaagatttta gagaaatggt cgaactggag       240
     ctggaagagc tttctgaaaa aaaagaagaa ctggtgcaga aactaaaact tttgctgttg       300
     cctaaggatc ctaacgatga taaaaacgtt atcctggaag ttcgagccgg taccggtggt       360
     gaagaggccg cgctttttgc cggggatctt ttccgaatgt acactcgcta tgcggaaaaa       420
     cagggttggc gcactgaagt attagatgcg aattacacgg atattggcgg ttttaaagag       480
     gttgtttgca tgattgaggg caaaggagca tatagcaggt taaagtttga aagcggtgtg       540
     cacagggtgc agcgggtccc ctctactgag tcaggcggac gcattcatac ttctgctgcc       600
     actgtggctg ttcttcctga ggccgaagag gtagagattg atattaaccc taatgattta       660
     agaatagatg ttttctgttc taccggaccg ggcggtcagt ctgtaaacac tacccaatca       720
     gctgttagaa tcacgcattt accttcgggt ttggtagttt cctgtcagga tgagaagtca       780
     cagcataaga ataaagataa agctatgcgg gttttgcgtg ccaggctaaa agatttggct       840
     gagtctgagc agcggagtga attagccagc accagaaaat caatggttgg ttccggtgat       900
     cgcagtgaga gaattcgtac ctataacttc cctcagaaca ggattacgga tcacaggatc       960
     gggctgacca ctcatcgtat gcctgctgtg ttaatgggag aaatggacga gattatcgaa      1020
     gctttgatta ctactgatca agcggatcgt ttgcgtagta cagagtaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page