(data stored in ACNUC7421 zone)

EMBL: CP001720.PE70

CP001720.PE70        Location/Qualifiers
FT   CDS_pept        76973..78229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0072"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bha:BH3784 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61035"
FT                   /db_xref="GOA:C8VVH0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVH0"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACV61035.1"
FT                   /translation="MSNIAIVGGQRLQGKVKVSGAKNATLAILGAALLANESIILENVP
FT                   DISDVRIMVNIIRDLGGEIDWLDKEVISFVPPKEIKKSPIYNNVKKLRASNLLLGPLLA
FT                   KFGYAEVALPGGCNIGVRPMDLHFKGLAGLGADLYIERGCVKGSAKKLAGARIYLDFPS
FT                   VGATENIMMAACLAEGQTIIENVAKEPEIVDLANFLNSLGGKVRGAGTDVIKIEGVKSL
FT                   DRGGRYAVIPDRIEAGTFMVAIAATRGDAILEGVIPRHIEPLIAKLREANVEITEEGDN
FT                   LRVRAVSQLNPIDIKTLPYPGFPTDMQSQVMTLLTNVPGTSIIIENIFENRFQISDELK
FT                   RMGAQIKVEGRMAVIEGVASLQGTVVKASDLRAGAALVIAGLMAEGVTEIINSFYIDRG
FT                   YQDLEDKLSSLGAKIWRND"
     atgagcaata ttgctatcgt aggggggcaa aggcttcagg gaaaagtaaa agtcagcgga        60
     gcaaaaaatg caactcttgc gatacttgga gcagctttgt tggctaatga aagtattatc       120
     ctggagaatg tgcccgacat aagtgatgtt aggataatgg taaatatcat tcgtgatttg       180
     ggcggggaga ttgattggtt ggacaaggaa gtaatatctt ttgttccgcc taaagaaatt       240
     aaaaaatctc ctatatataa taatgtaaag aaattgcgcg cctccaattt attgcttggg       300
     cctctattgg ccaagtttgg ttatgctgaa gtggctcttc ccggagggtg caatatcgga       360
     gtgcggccta tggacttgca ttttaaaggg ttggccggtc taggtgcgga tttatatata       420
     gagagaggtt gtgtcaaagg atctgctaag aaacttgcag gtgccagaat atatcttgat       480
     tttcccagtg ttggagctac tgagaatata atgatggctg cctgtctggc tgagggacag       540
     actattattg aaaacgttgc caaggagccg gaaatagttg atttggcaaa ttttttaaac       600
     agtctgggcg gcaaagtgcg aggggcaggc acagatgtta taaaaataga aggagtaaaa       660
     tctttagatc gcggtggtcg ctatgctgta attcctgatc gcattgaggc cggaactttt       720
     atggtagcta ttgcggcgac aaggggtgat gcgatccttg agggggttat tcccaggcat       780
     attgagcctc ttatagccaa gttgcgggag gctaatgttg agataactga ggaaggggat       840
     aatctaagag tcagagcggt tagccaacta aatcccatag atatcaagac gctgccttac       900
     cctggttttc caactgatat gcagtcgcag gtaatgacgc tgctgacaaa tgtgccggga       960
     accagtataa ttatagagaa tattttcgaa aatagatttc agatttcaga tgaattaaag      1020
     agaatgggag ctcaaatcaa ggttgaaggg cgtatggctg taattgaggg tgttgcatct      1080
     ttacagggga ctgttgttaa ggcctctgat ttgcgggccg gtgctgcttt ggtaattgcc      1140
     ggtttaatgg cagaaggagt taccgaaatc atcaattctt tttacattga caggggatac      1200
     caggacttgg aggataaatt atcttcgctg ggtgctaaga tctggagaaa cgattga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page