(data stored in ACNUC7421 zone)

EMBL: CP001720.PE73

CP001720.PE73        Location/Qualifiers
FT   CDS_pept        79361..80230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0075"
FT                   /product="Nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   ppd:Ppro_1535 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61038"
FT                   /db_xref="GOA:C8VVF4"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF4"
FT                   /inference="protein motif:PFAM:PF02665"
FT                   /protein_id="ACV61038.1"
FT                   /translation="MNFFVGQVMPYITIIVFTVGILYRLSRWGRTRIVHNITLSDNIGP
FT                   THWPKSNAEVLALIGSEAFLFRSLFRFDKGLWAGAWIMHISLLNILGGHVVGFYTLGKQ
FT                   FTYIGMSEAMSEHASELLGTSFGIIIFFALLYLLYRRLAVAAVKQVTVTSDILQLLLLI
FT                   GIVSAGNFMRLFPDYAVHYETANSIVGGIVHLNPVALPDNIFFTIHFFLVQVLLMIFPF
FT                   SKLMHVLGMFVERNIVNRVYKELPPGLPGINVPVENAVDVLYSPSIEARDNCPACVSVS
FT                   GGVKNAGV"
     ttgaatttct ttgtaggcca ggtaatgccg tatatcacta ttattgtttt tacggtaggt        60
     atattgtatc gtctgagtcg ctggggtcgt acccgtatag ttcacaatat tactctttcc       120
     gataatatcg gtccgactca ttggcctaag tcaaacgctg aggtgctggc gttgatcggt       180
     tctgaagcct ttttgtttag aagtttattc agatttgaca agggcttatg ggcaggtgca       240
     tggattatgc atatttccct gcttaacatt cttggtggtc acgtagtagg tttttatacc       300
     ctcggcaaac agtttaccta tatcggtatg tcggaagcaa tgagcgagca tgcatccgaa       360
     ttattgggta cttcctttgg tatcataata ttctttgcgc ttttgtattt attgtacaga       420
     cgtttagcag ttgccgcagt taagcaggtt actgtaacaa gcgatatact ccaactttta       480
     ttgcttatcg gtattgtttc tgccggtaat tttatgcgct tattcccgga ctacgctgtg       540
     cactatgaaa ctgctaacag cattgtaggc ggtattgttc atcttaatcc ggttgctttg       600
     cctgataata ttttctttac aattcacttt ttcttagtgc aagttctatt aatgattttc       660
     ccgtttagta aattaatgca tgttttaggc atgtttgttg agcgtaatat tgtaaaccgt       720
     gtttataaag agttgccgcc agggttgcct ggtattaatg ttcctgttga aaatgcggtt       780
     gatgtattat attcacccag tattgaagcc agggacaact gtcctgcctg tgtttctgtc       840
     tcgggaggtg taaaaaatgc cggagtataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page