(data stored in ACNUC7421 zone)

EMBL: CP001720.PE75

CP001720.PE75        Location/Qualifiers
FT   CDS_pept        81736..82053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0077"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="TIGRFAM: sulfur relay protein, TusE/DsrC/DsvC
FT                   family; PFAM: DsrC family protein; KEGG: dat:HRM2_22050
FT                   DsrC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61040"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:C8W193"
FT                   /inference="protein motif:TFAM:TIGR03342"
FT                   /protein_id="ACV61040.1"
FT                   /translation="MAAIEINGVSYELDEDGFLVDPAAWSKDLALAFAKDEGISEITEE
FT                   HWKIIEYLRDYYQQFQVAPMVRKLCKETGVTLKHMYELFPSGPAKGACKLSGLPKPTGC
FT                   V"
     atggcagcta ttgaaattaa tggtgttagc tatgagttgg atgaagatgg ttttttagtg        60
     gatcccgcag cctggtcaaa agatttagct ttagcttttg ctaaagacga aggtatctca       120
     gaaatcactg aagaacactg gaaaattatt gagtatctcc gcgactatta tcagcaattc       180
     caagttgctc cgatggtacg taagctttgt aaagaaacag gtgtaaccct taagcatatg       240
     tatgagttat ttccctctgg cccggctaag ggtgcctgca aactttccgg cctgccgaaa       300
     ccaactggtt gtgtataa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page