(data stored in ACNUC7421 zone)

EMBL: CP001720.PE79

CP001720.PE79        Location/Qualifiers
FT   CDS_pept        86595..86828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0081"
FT                   /product="Dissimilatory sulfite reductase D"
FT                   /note="PFAM: Dissimilatory sulfite reductase D; KEGG:
FT                   dvl:Dvul_2530 dissimilatory sulfite reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61044"
FT                   /db_xref="InterPro:IPR014793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z0"
FT                   /inference="protein motif:PFAM:PF08679"
FT                   /protein_id="ACV61044.1"
FT                   /translation="MDEIKKAILEFAETSKKTKFYFKDMEKAIQKVLPDAKARDIKKAA
FT                   SALVNEEVLIYFSTGSSTMYGLKGRGMTEDPE"
     atggacgaaa ttaaaaaagc catccttgag tttgctgaaa ccagcaagaa aactaagttt        60
     tatttcaagg acatggaaaa ggccattcaa aaggtccttc cggatgcaaa agccagggat       120
     attaaaaagg ctgccagtgc acttgtaaat gaagaagtct tgatttattt ttctaccggc       180
     agcagcacta tgtacggctt aaaagggaga ggcatgacag aagatcccga ataa             234
//

If you have problems or comments...

PBIL Back to PBIL home page