(data stored in ACNUC7421 zone)

EMBL: CP001720.PE8

CP001720.PE8         Location/Qualifiers
FT   CDS_pept        9395..9616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60973"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60973.1"
FT                   /translation="MQSSLKNNLQKIAQRKIVNINDYQKVDIVANDHTVEQIKKICQRT
FT                   GLTISQVIEGIIRTALEDKNLTAVSGNS"
     ttgcaaagtt cacttaagaa taatttacag aaaattgctc aaagaaagat tgttaatatt        60
     aatgactatc aaaaagtaga tattgttgct aatgatcata ctgttgagca gattaagaaa       120
     atatgccaga gaacaggatt aactatttct caagtaattg agggtataat cagaactgct       180
     ttggaagaca aaaatcttac agctgtttca ggaaacagct aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page