(data stored in ACNUC7421 zone)

EMBL: CP001720.PE80

CP001720.PE80        Location/Qualifiers
FT   CDS_pept        86931..87557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0082"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Sel1 domain protein repeat-
FT                   containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: dde:Dde_3772 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61045"
FT                   /db_xref="GOA:C8W1Z1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z1"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACV61045.1"
FT                   /translation="MKIPKSAEKFIAEQISLINENPECANAHYNLGVTMMELGQYDQAI
FT                   ELFEEAIANSGRMFEGYVNLGYIYLKKRDLEMVAATNKKAVEIEPRYARGYANMGFAYL
FT                   EMACPDEAIEALEKAIELNPEIVQAWSNLINAYLQKDEIDKAIETGKKLIEFAPEFSLG
FT                   QNNLATAYYLNEEYDKAIEHLDIAMRQGFSVHPDFLKELQPYRER"
     atgaaaatac caaaaagcgc tgaaaaattc atagctgaac aaataagttt aataaacgag        60
     aatcccgagt gcgctaatgc tcactataat ttgggagtta cgatgatgga gttaggccag       120
     tatgatcaag ccattgagtt gtttgaagag gctatagcga acagcggaag aatgtttgag       180
     ggatatgtaa atttgggtta tatatacctg aaaaagagag atctggagat ggtggcagca       240
     accaataaaa aagcagttga aatagaaccc aggtatgcca ggggttatgc taacatgggt       300
     tttgcttatt tggagatggc ctgtcctgat gaagctatag aagctctgga aaaggccatt       360
     gaacttaacc ccgaaatcgt tcaagcatgg agcaacctga ttaacgcgta cctgcaaaag       420
     gatgaaatag ataaggccat tgagacaggt aaaaaattaa tagaatttgc cccggaattt       480
     tcattagggc aaaataatct tgccactgct tattatttaa atgaagaata tgacaaggct       540
     attgaacatt tggatattgc tatgcggcag ggtttttctg tacaccctga ctttttaaaa       600
     gaactgcagc cctataggga gagataa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page