(data stored in ACNUC7421 zone)

EMBL: CP001720.PE82

CP001720.PE82        Location/Qualifiers
FT   CDS_pept        88158..88358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61047"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61047.1"
FT                   /translation="MDRFGSLMNTGGYFILANAKAVVIRLNNMSTGKTVSVKDNLSEKW
FT                   QFYSNPDTRKIKAISAFSEKS"
     gtggacaggt ttggtagttt aatgaataca ggaggatatt ttattttagc taacgctaaa        60
     gctgtagtta ttaggctaaa taatatgagc acaggaaaga ccgtatcggt gaaagataat       120
     ttgtctgaaa aatggcagtt ttatagtaat ccagatacaa gaaaaataaa ggcaatctct       180
     gctttctcag aaaaaagctg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page