(data stored in ACNUC7421 zone)

EMBL: CP001720.PE86

CP001720.PE86        Location/Qualifiers
FT   CDS_pept        complement(90540..94163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0088"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: eca:ECA2957
FT                   pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61051"
FT                   /db_xref="GOA:C8W1Z7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z7"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV61051.1"
FT                   /translation="MAKASKTMDGNEAAAYISYPFTEVAAIYPITPSTPMAESVDLWAA
FT                   HGKKNFFGQTVRVVEFQSEAGASGGMHGSLAAGALTTTYTASQGLLLMIPNMYKMAGEL
FT                   LPAVFHVTARAIATHALSIFGDHQDVMSCRQTGVALLASASVQEAMDLGCIAHLSAIKS
FT                   RIPFLHFFDGFRTSHEVQKIEVLDYTEVSKLLDYEAIKEFRDRSLNPEHPSIRGTAQNP
FT                   DIYFQGREASNPLYDKVPDIVESYMREISRITGRDYKPFDYYGAEDAEYVIVAMGSVCE
FT                   TIDETIDYLRGKGEKVGTIRVRLYRPFSAQHFFNVLPPSVKSIAVLDRSKEPGSVGEPL
FT                   YLDIVKSFYNKDKKPVLVGGRYGLGSKDTRPSQIIAVFNNLKSGTPKDRFTIGIHDDVT
FT                   HTSLPEEDIIETTPQGTINCKFWGLGSDGTVGANKTAIKIIGDNTNLYAQGYFSYDSKK
FT                   SGGTTVSHLRFGKQPIRSTYLVYNADYIACHNSSFIFHYDLLKGLKKNGTFVLNCHWKT
FT                   NELEEKLPSYIKRYLAQNHINFYIINAIDIASEIGLGARINMIMQAAFFKLANVIPLEN
FT                   AVKYLKDSIVSSYGHKGQNIVDMNNKAVDKGISSLVKVEVPAGWANADDENQPVKEEPF
FT                   FTKNFQRPMARMEGDELPVSAFKGREDGTFPLSTTAYEKRGIAARIPQWQPEKCIQCNQ
FT                   CSFICPHAVVRPFLLNEEEVKKAPSSFITKKATGKGLEGLQYRIQITPLDCTGCGNCAD
FT                   VCPAPGKALIMNDPEEEIAAQSDNWEFARLLTGKSHLIDHRTVKGSQFAKPLFEFNGAC
FT                   PGCGETPYIKLLTQLFGDRMMIANATGCSSIYSASAPSFPYTTTAEGKGPAWGNSLFED
FT                   NAEYGYGMLLGVSQIRERLADLMRTALGEKSAGELNSDLTLEAAHGKASDQVLRQISPE
FT                   AAAVPLSAELQEAFREWLAGMYDGEASKSAAAKILAALKDFGNAENQLIKEIIDKKDFL
FT                   IKKSQWIIGGDGWAYDIDFGGLDHVLAAGEDVNMLVLDTEVYSNTGGQSSKSTPTAAVA
FT                   KFAASGKKIKKKDLGMMMMNYGYVYVAQICMGANMNQTVKAMVEAESYKGPSLIIAYSP
FT                   CINHGIRSGMGTSIAEEKKAVEAGYWHMYRYNPMLKEEGKNPFILDSKEPNESYKDFIK
FT                   GEIRYSSLLNAFPEHAEKLMEESAKQARERYEGYKKLAETK"
     atggccaagg catcaaaaac tatggacggc aatgaagcag ctgcctatat ctcttatcct        60
     tttacggaag tggcagccat ctaccccata acaccctcta cacccatggc cgagagtgtg       120
     gatttatggg ccgcccatgg taaaaagaac tttttcggac aaacggtgag agttgtcgaa       180
     ttccaatcag aggcaggagc atcgggaggg atgcacggtt cactggcagc cggcgcattg       240
     accaccacat atacggcttc ccagggtctc ttattaatga tacccaatat gtataaaatg       300
     gcgggtgaac tgctccccgc ggtatttcat gttaccgcca gagctattgc aacacatgct       360
     ctatccatat tcggcgatca ccaggatgtt atgtcctgcc gccaaacagg cgtggctctg       420
     ctggcctctg ccagcgtaca ggaggctatg gatttaggct gcattgctca cctgtcagcc       480
     atcaagtcca gaataccctt tctgcatttt tttgatggtt ttagaacctc tcacgaagtg       540
     caaaaaattg aggtgctgga ttataccgag gtatctaaac tcttggatta cgaggcaatc       600
     aaagaatttc gcgacagatc cttaaaccct gagcaccctt ctataagagg aacagcacag       660
     aatccggata tctattttca gggcagagaa gcctccaacc ccctatatga taaagtgccg       720
     gatatcgttg agagctacat gcgggaaatc agcagaataa ccgggcgtga ttacaaacct       780
     ttcgactatt acggagcgga agacgccgaa tatgtgatcg tagccatggg ttcagtctgc       840
     gaaacaattg atgaaacaat agactacctc cgcggaaaag gagaaaaggt aggaacaata       900
     agagtacgct tataccgccc tttctcggct caacatttct ttaatgtgct gcctccgagc       960
     gtaaaaagca tagcggtact ggacagaagc aaggaacccg gttctgtagg tgaaccctta      1020
     tatctggata ttgtcaaatc cttttacaac aaagataaaa aacccgttct tgtcggaggc      1080
     cgttacggct tgggctcaaa agataccaga ccttcacaaa taatagctgt ctttaataac      1140
     cttaagagtg gtactccaaa agatcgtttt actattggca ttcatgacga tgtcactcat      1200
     acatctctgc ctgaagaaga catcattgaa acaacaccac aggggactat caattgcaag      1260
     ttctgggggt tgggctcaga cggtacggta ggcgccaata aaaccgctat taaaattatt      1320
     ggtgacaata ccaatcttta tgcccagggc tatttttctt acgacagtaa aaaatccgga      1380
     ggtacaactg tttcccactt aagatttggc aaacaaccta tacgatcaac ttatctggtc      1440
     tataatgctg actatatagc ctgccataac agttccttta tttttcatta tgacttacta      1500
     aaaggcttga agaaaaacgg cacctttgta ctgaactgcc actggaaaac caacgagctg      1560
     gaagagaaac taccgtccta tataaaaaga taccttgctc aaaaccatat taacttttac      1620
     atcattaacg ctatagatat agcatctgaa atcggtctgg gtgccagaat aaatatgatc      1680
     atgcaggccg ccttttttaa actggccaat gtgattcccc tggagaatgc agttaaatat      1740
     ttaaaggatt ctattgtatc cagttatggg cataagggcc aaaatattgt agatatgaat      1800
     aataaagcgg tagacaaagg tatctcctct ctggtcaaag ttgaggttcc ggcaggctgg      1860
     gctaacgcag atgatgaaaa ccaacccgtt aaggaagaac cttttttcac taagaatttt      1920
     caaagaccga tggccagaat ggaaggtgac gaactgcctg tcagcgcctt taagggcaga      1980
     gaagacggca cttttccttt aagcacgacg gcctatgaaa agcgaggtat tgccgcaaga      2040
     atacctcagt ggcaaccgga gaaatgcatc cagtgcaacc agtgttcttt tatctgcccc      2100
     catgctgtag tgaggccttt cctgctgaat gaagaagaag tcaaaaaagc cccctcttct      2160
     tttataacca aaaaggcaac cggtaaaggg ctggaaggac tgcaataccg tattcagata      2220
     acccctcttg attgtaccgg ctgcggaaac tgtgccgatg tttgcccggc tcccggcaag      2280
     gctctgatca tgaacgatcc ggaagaggaa attgccgcac agtcagataa ttgggaattc      2340
     gctcgattgc tcaccggcaa atctcactta atagaccacc ggactgtcaa aggcagccag      2400
     tttgccaagc ccttatttga atttaacgga gcttgtcccg gctgtggcga aaccccttac      2460
     ataaagcttt taacacagct gttcggggac agaatgatga ttgccaacgc taccggttgt      2520
     tcgtccatat acagcgccag cgccccctct tttccttata ctacaactgc tgaaggaaaa      2580
     ggaccggcct ggggcaactc tctgttcgaa gacaacgcgg aatatgggta cggtatgctt      2640
     ctgggtgtta gccagataag agagaggctg gccgatttaa tgagaactgc tctgggagaa      2700
     aaatctgccg gggaactgaa ttctgactta accttagaag cagcacacgg gaaagcttca      2760
     gatcaagtct tacggcaaat ttcacccgaa gcagctgccg tcccgctaag tgcagagctt      2820
     caagaggcct ttcgggagtg gctggcaggg atgtatgacg gcgaggcttc caaatctgct      2880
     gcagcaaaaa tacttgcggc gctaaaagac tttggtaatg ctgaaaacca acttataaaa      2940
     gagattattg ataaaaaaga tttcttgata aaaaaatctc aatggattat cggtggtgac      3000
     ggttgggctt atgatataga cttcggcggc ttggatcatg ttctggcagc cggcgaagat      3060
     gtcaatatgc tggtattgga tacagaggtt tattccaata ccggaggaca atcatcaaag      3120
     agcaccccca ccgctgctgt agccaagttt gccgcaagcg gtaaaaagat caagaaaaag      3180
     gacctgggca tgatgatgat gaattacggt tacgtctatg ttgcccagat atgtatgggg      3240
     gctaatatga accaaactgt gaaagctatg gtggaagcag aaagctataa gggaccctcc      3300
     ctgatcatag cctactctcc ttgcattaac catggcatca gatcaggtat gggcaccagc      3360
     atagctgagg agaaaaaagc agttgaagcc ggctactggc atatgtaccg ctataacccc      3420
     atgcttaaag aagagggtaa aaatcccttt attctggatt ctaaggaacc taacgaatcc      3480
     tataaagatt ttatcaaagg tgaaatccgc tactcttcac tgttgaatgc attccctgag      3540
     catgccgaaa aattgatgga ggagtctgca aaacaggcca gagagagata cgaaggctac      3600
     aagaagctgg ctgaaacaaa ataa                                             3624
//

If you have problems or comments...

PBIL Back to PBIL home page