(data stored in ACNUC7421 zone)

EMBL: CP001720.PE87

CP001720.PE87        Location/Qualifiers
FT   CDS_pept        complement(94315..96738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0089"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61052"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032329"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z8"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61052.1"
FT                   /translation="MKSKYTLFCLTFLISILFCGSAYADFKPPAYTDIKGSFAEDSINK
FT                   LVEKGIITGVNSQEFCPNNNLNRYDFTVLIAKTLGIQPIFPTAATFSDLPSGTLETGYV
FT                   EALFKLGMIKGIDKNHFGVNEPVLRQDAAVLIQRTMAEEIDVPSLSGRYADSGQIASYA
FT                   IKGVDFVSWKGWMNGSENNFYPLRPITRAEAAVLAYRLLIIRTGQASTAFEHISSDLVQ
FT                   LETESECQLEQRGSKKALNFSTTYGLDNQALFSVTPSGSIVSGKESGTGLITVNSGSNY
FT                   YSVTTKVSAPKANNTVQNSVYKDFAAELANKSTYTVTQTEPDPVHSQVEKNSYPGPPEG
FT                   ITSSSDTWTGFLRQKSRDITVDLKKICSISYISMEFNRNETMGIYLPDYMQCSASPDGI
FT                   SWYKLGYAYRNSDLPAGTKEQNVTLTLVLPAANFRYVRVSFPVELWVFARHLSIRGDEA
FT                   AVDPVILAHSDSANKNVSSSPYIKVPGSKNILLIYTGDKSKKADWTAGDFIPVVAYMDE
FT                   NRRIKGSMFDTMLFLPYSFEITCTKESWNAYLEDLFNPVKQLNALNLAVGQINQITGQQ
FT                   EKEKVILSLPYPSVDQQDFGQLDKNEPSLSFSETQLGKEQAEKNRFAAVQWYYNKLMEK
FT                   WQQADFKNLELIGIYWYEESVDYHNIKSETALVQKTARLVQDNKLKFFWIPYYGAIGFE
FT                   DWKKFGFDYAFIQPSFYNSEQLPIERMDKAAELARKYNMGIEIEFDDEILNGDYFNDLL
FT                   HKQLDKAHQLGLDDSKTTRAFYMGLRAIVTCSRSNQPQARATYDLLYKWLNGNY"
     atgaaatcaa aatacacact tttttgccta acatttctca tctcaatttt gttttgcggg        60
     tcagcctatg ctgattttaa accaccggca tatacagata ttaagggttc ctttgcagag       120
     gattcaatca acaaactggt tgaaaaaggc atcattacgg gtgttaactc tcaagaattt       180
     tgtcctaaca acaatctcaa ccgttatgat tttactgttt taattgccaa aacattaggc       240
     atacaaccca tttttccgac tgcagccact ttctctgatt taccgtcggg aacattggaa       300
     acaggctacg tagaggcttt atttaaactg ggtatgataa aaggcataga caaaaatcat       360
     tttggagtaa acgagccggt gttaagacag gacgccgctg tgttaattca aagaacaatg       420
     gcagaagaaa ttgatgtgcc ttctttaagc ggcagatacg ccgattcagg tcaaatcgct       480
     tcttatgcta taaaaggcgt agactttgtt tcatggaagg gctggatgaa cggcagcgaa       540
     aataatttct atccattacg gccaataaca agagcggaag ctgctgtttt agcttatagg       600
     ttactcatta tcagaacagg acaggcctcc acagcttttg agcacatatc ttccgacctg       660
     gtacagttag aaactgaatc agagtgtcaa ctggaacaac gcggcagcaa aaaagcttta       720
     aatttttcca caacctatgg attggataac caagcgcttt tttcagttac tccaagcggc       780
     agcatagttt ccggaaaaga atccggaacc ggtttgatta cagtaaactc cggcagcaat       840
     tattattctg taacaacaaa agtatctgcc cctaaagcaa acaacaccgt acaaaactcc       900
     gtatacaagg attttgctgc cgaactggcc aataaatcaa catatactgt aacacaaaca       960
     gaacctgatc ctgtacacag ccaggtagaa aaaaacagtt atcccggccc accggaaggg      1020
     attacttcca gcagcgatac atggacaggg tttctgcggc agaaatcacg tgatatcaca      1080
     gtagacttga aaaagatatg ttctatatcg tatatttcta tggaatttaa cagaaacgaa      1140
     actatgggta tatatttacc tgattacatg caatgctctg catcacctga cggcatcagc      1200
     tggtataaat taggttatgc gtaccgtaac agtgatttgc ccgccggcac aaaagagcaa      1260
     aacgttacgc taacccttgt tttaccagcg gcaaactttc gttatgtaag agtatccttt      1320
     cctgtagagt tatgggtttt tgcaagacac ttatccatca gaggagacga ggctgctgtt      1380
     gatccagtca ttcttgccca ctctgactca gcaaataaaa atgttagcag cagtccctat      1440
     atcaaagttc ccggaagcaa aaatattttg cttatttata cgggagataa aagcaagaag      1500
     gcagattgga cagcaggtga ttttattccg gttgtagctt atatggatga aaacagacga      1560
     atcaagggca gcatgttcga tacaatgctg tttctccctt attcgtttga gataacttgt      1620
     acaaaagaaa gctggaatgc ttatctggaa gatttgttta acccggtcaa gcagcttaac      1680
     gcacttaatt tagcagtggg gcaaataaac cagataaccg gtcagcaaga aaaggaaaaa      1740
     gttattctct cacttcctta tcccagtgtt gaccagcaag actttgggca actggacaaa      1800
     aatgaacctt cactttcttt ttctgagact caattaggaa aggaacaggc tgaaaaaaac      1860
     aggtttgctg cagtacaatg gtactataac aaactgatgg aaaaatggca gcaagctgat      1920
     ttcaaaaacc tcgagttgat aggtatctac tggtacgagg aatcagttga ttatcataat      1980
     atcaagagtg aaacagcatt ggtgcaaaaa accgcccgac tggttcagga caacaaacta      2040
     aaatttttct ggattcctta ttacggtgcg attggctttg aggattggaa aaagtttggt      2100
     tttgactacg cttttattca acccagcttc tataacagtg aacagcttcc gattgaacgc      2160
     atggataagg cagccgaact tgccaggaaa tataatatgg ggattgaaat agaattcgat      2220
     gatgaaattc ttaatgggga ttacttcaac gatttactcc ataaacaact ggataaagcg      2280
     catcagcttg gtttagatga cagtaaaacg accagagcct tttacatggg cttgcgcgcc      2340
     attgtcactt gttcccgcag caatcaacca caggctaggg ccacctacga tcttctctat      2400
     aaatggctta acggcaacta ctaa                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page