(data stored in ACNUC7421 zone)

EMBL: CP001720.PE9

CP001720.PE9         Location/Qualifiers
FT   CDS_pept        9951..11333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0009"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sat:SYN_02917 FAD-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60974"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACV60974.1"
FT                   /translation="MIIVGAGPAGIFSALELIKNQSDLRILIVEKGRDLVNRKCISKEK
FT                   NISCAQCSPCSIVCGWGGAGAFSDGKLTLSTEVGGTLDKYIGVNELVQLIEYVDSIYVK
FT                   FGAPDKVYGGDNEDENQTFQRKAVLAGLKLVPILIRHLGTGRCMQILLAMKEHLLSSGV
FT                   EVLTNCSVESVLTEDKTVTGIKTADGNVYESGYVILAPGREGSSWLSAEADRLGIKTAV
FT                   NPVDIGVRVELPHSVMKPLTEIFYESKFIYHSKTFEDPVRTFCMNPYGEVVLENNDGLI
FT                   TVNGHSHAYKKTKNTNFAILVSNKFTEPFKEPITYGKNVAALANLLSGGVIIQRLGDLL
FT                   NGRRTTQDKLERCPVEPTLKEAKPGDLSFVFPYRQLTSILEMLKAMDRIAPGVYSRYTL
FT                   LYGVEVKFYSSRLDLNNLLETPINNLFAAGDGPGVTRGLAQASAAGVLAARQILKRINQ
FT                   NK"
     gtgataattg taggggccgg acccgccggt attttcagtg ctctagagtt gataaagaat        60
     caatctgatt tacgaatact gatagttgaa aagggtagag atttagtaaa tagaaaatgt       120
     atttccaagg aaaagaatat aagctgtgca cagtgttctc cctgttcaat agtatgtggt       180
     tggggtggcg ccggtgcttt cagtgacggt aaacttactc tgtctactga agttggaggc       240
     acgctggata agtatatcgg tgttaatgaa ctggttcaat taatagagta tgtggatagt       300
     atatatgtga agtttggtgc tcctgataaa gtgtacggtg gtgataatga ggacgagaat       360
     caaacatttc agagaaaagc tgttttagcc ggtttaaaac tcgtgcctat attaattcgc       420
     catcttggta caggaagatg catgcaaata ttactggcta tgaaagaaca cttattatca       480
     agcggtgtag aagttcttac aaattgttct gtagaatcag tcttgacaga agataaaaca       540
     gtaacaggga taaaaacagc tgatggtaat gtttatgaga gtggttatgt cattctggct       600
     ccgggaaggg agggttcttc ctggctttct gctgaagcag acagattggg cataaaaacc       660
     gctgttaatc ctgttgatat aggtgttagg gtagaattgc cgcattccgt tatgaaacca       720
     ttaacagaaa ttttttatga atcaaaattt atatatcact cgaaaacttt tgaagatccg       780
     gtccgtacat tttgcatgaa cccttatggt gaagttgttt tagaaaataa cgatggacta       840
     attacagtta atggccattc acatgcttac aagaaaacaa aaaatacaaa ctttgccata       900
     ttggttagca ataagtttac cgaacctttt aaagaaccta ttacttatgg taaaaatgta       960
     gcagccctgg ccaatctttt aagtggtggt gtaataattc aacgcctggg agatttatta      1020
     aatggacgcc gtacaacaca agataaatta gagagatgcc cggtagaacc aactttaaaa      1080
     gaagctaaac cgggtgattt aagttttgtt tttccttaca ggcagttaac cagtatttta      1140
     gaaatgttga aagctatgga cagaatagcg cccggagtgt attcccgata tactcttttg      1200
     tatggggtag aagtaaaatt ttattcatct cgtttagatt taaataattt actggaaaca      1260
     cctataaata acttatttgc tgccggtgac ggcccgggag ttaccagggg attagctcag      1320
     gcatctgctg cgggtgtttt ggcagccaga caaatattaa aaaggataaa tcaaaataaa      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page