(data stored in ACNUC7421 zone)

EMBL: CP001720.PE90

CP001720.PE90        Location/Qualifiers
FT   CDS_pept        99928..101511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0092"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: baa:BA_0613 ATPase family associated with
FT                   various cellular activities (AAA); TIGRFAM: DNA polymerase
FT                   III, subunits gamma and tau; PFAM: AAA ATPase central
FT                   domain protein; DNA polymerase III delta; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61055"
FT                   /db_xref="GOA:C8W2P9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2P9"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACV61055.1"
FT                   /translation="MAYRALYREYRPQLFAEIMGQRHIVDTLENALKNNRIAHAYLFCG
FT                   PRGTGKTSTAKILAKALNCHQIKGVEPCNKCSSCVSVAQGSAIDVIEIDAASNRGIDEI
FT                   RDLKERVKFAPTGGKYKVYIVDEVHMLTIEAFNALLKTLEEPPEHVIFVLATTEPHKLP
FT                   LTILSRCQRFDFKSIGAEPMTSRLKDILQDLQVKISPAALELIVQAAEGGLRDALSILD
FT                   QIITFNNTAEISEEDIHNLLGTVNERVINSLLEYLLRGDAGSSLQVIAEIFLEGKDLKM
FT                   FVKGFASCVRDLLLQSIEPTAIKNFSRTDQIYSVEYLLALLDCLTELEPKMKFSSQPRV
FT                   ILELALIKFIYSRRDHLLQSINTKESTEIQNNQDMRVSLPSEVKLPADDQEKLLAENTD
FT                   NSKLVKSYDLPVAEKNEQRDNISINRVKNSWKLVLEEIRKAMPAIAVPLSDGYPVRIEN
FT                   NVLSIGIRNDFNRQRLDSNQKCRDIIKQTIKSILGWECQFKFIEVSELAQDIPETEDIT
FT                   TQSIINLFEA"
     atggcttacc gtgctttgta cagagaatac cggccacagt tatttgcgga aataatgggc        60
     caaagacata ttgttgatac cctggaaaac gcgttaaaaa acaaccgcat tgcacatgct       120
     tatttatttt gcggtcccag gggcaccggt aaaaccagta cagccaagat actggctaaa       180
     gctctgaatt gtcatcagat aaaaggtgtg gagccttgta ataagtgtag tagttgcgta       240
     tctgttgccc agggttctgc tatagacgtt attgagattg atgctgcctc caaccgtggg       300
     attgatgaaa taagggattt aaaagagaga gttaagtttg ctccgacggg cggtaaatat       360
     aaggtatata ttgttgacga ggtgcatatg ttgacgattg aagcctttaa cgcgttattg       420
     aaaaccttgg aagaaccacc cgagcatgtt atatttgttt tggcaactac ggagccgcat       480
     aaattacccc taaccatttt atcacgctgt cagagatttg attttaaaag tattggcgca       540
     gagcctatga catccaggtt gaaggatatt ttgcaggatt tgcaggttaa aatcagccct       600
     gctgctttgg aattgatagt acaagcggcg gaaggcggtc taagagatgc tctaagcatt       660
     ctggatcaaa taataacttt taacaataca gctgaaattt ctgaagaaga tatacataac       720
     ctgttgggta cggtaaatga aagggttatt aatagtttgt tagagtatct tttacggggg       780
     gatgccggca gttcactgca agttattgct gaaattttcc tggaaggcaa ggatttaaag       840
     atgtttgtta aagggtttgc ctcctgtgtt agagatttgt tgctccaaag cattgagcca       900
     actgcaataa aaaacttttc tcggacagat caaatttatt ccgttgaata tttattggct       960
     ttgttggact gcttaacgga gctggaaccc aaaatgaagt tcagctccca gccaagggta      1020
     atcttggagt tggcactgat taaatttatt tatagcagac gggatcacct gctgcaaagc      1080
     attaatacta aagaaagcac tgaaattcaa aataatcagg atatgagagt atctttaccg      1140
     tcggaagtta aattgccggc agatgatcaa gaaaagttgc ttgcagaaaa tactgataac      1200
     agcaagcttg ttaaaagtta tgacttgccg gttgcagaga aaaacgagca gagggacaat      1260
     atatctataa atagagttaa gaattcctgg aagctcgttt tggaagagat caggaaggcc      1320
     atgccggcta tcgctgtacc cctgtcagac gggtatccgg tcagaataga aaataatgtg      1380
     ctttcaatag gtattcgtaa tgactttaac aggcaaaggt tagatagtaa tcaaaaatgc      1440
     agggacataa ttaaacagac gataaaatca attttgggat gggaatgtca atttaaattt      1500
     attgaagtaa gcgagttggc acaggatatt cctgaaacag aggatataac tacccagagc      1560
     attatcaatt tgtttgaagc ataa                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page