(data stored in ACNUC7421 zone)

EMBL: CP001720.PE91

CP001720.PE91        Location/Qualifiers
FT   CDS_pept        101549..101863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61056"
FT                   /db_xref="GOA:C8W2Q0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV61056.1"
FT                   /translation="MGGNMNKMMKQVQKMQADMLKMQEELANRTVVSTAGGGAVKVTVN
FT                   GKQEILAIEIKPEAVDPEDVEMLQDLILAAVNEGIKNSQEMVNKEMGKLTGGLNIPGLF
FT                   "
     atgggcggta atatgaataa aatgatgaag caagttcaaa aaatgcaggc tgatatgtta        60
     aagatgcagg aagaactggc taaccggact gtggtcagca ctgccggtgg tggagcagtt       120
     aaggttacgg taaatggtaa gcaggaaatc ctggcaattg aaataaaacc ggaagcggtg       180
     gatcctgaag atgttgaaat gctgcaggat ttaatcctgg ctgctgttaa cgaaggaatt       240
     aagaattctc aggaaatggt taacaaggaa atgggtaaac taacaggcgg tttgaatatt       300
     cccggcttgt tttag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page