(data stored in ACNUC7421 zone)

EMBL: CP001720.PE92

CP001720.PE92        Location/Qualifiers
FT   CDS_pept        101875..102474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0094"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bsu:BSU00210 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61057"
FT                   /db_xref="GOA:C8W2Q1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q1"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACV61057.1"
FT                   /translation="MLNHSGVVSRLINEFSLLPGVGPKTAQRIAFYLLNAPEEVAHRLA
FT                   EAVREARDNIKYCSVCSNLTDVDPCLICSDNKRSKNIICIVQEPRDVIAMEKSRGFKGL
FT                   YHVLHGAISPMDGIGPENLRIKELLSRLHKEKVGELILATNPNVEGDATAFYLARLIKP
FT                   LGIKVTRIAHGLPVGACLEYADGVTLTKALEGRQEI"
     ttgctaaacc attccggagt ggtaagtcgc ctgataaatg agttttcttt attgcccggg        60
     gtcggtccta aaactgctca gagaatagct ttttatcttt tgaacgcacc ggaagaggta       120
     gcccaccggt tggctgaggc agtgagggag gcccgtgata acatcaaata ctgctccgta       180
     tgcagcaact taacggacgt tgatccttgt cttatttgca gcgacaataa gcgcagcaaa       240
     aacattatat gtatagttca ggaacctcgt gatgtcatag ctatggaaaa gagccgtggc       300
     tttaaaggac tctaccatgt tctgcacggt gctatctctc cgatggacgg tattgggccc       360
     gaaaatctga ggatcaaaga gcttttgagc agattgcata aggaaaaagt cggagaattg       420
     attctggcca ccaaccctaa cgtggaaggg gatgccacgg ctttttattt ggcgcgatta       480
     attaagcctt taggcattaa ggtaaccagg attgctcatg gtttaccggt aggtgcttgc       540
     ttggagtatg ccgacggggt aactttgacc aaagcattgg aaggcaggca ggagatttag       600
//

If you have problems or comments...

PBIL Back to PBIL home page