(data stored in ACNUC7421 zone)

EMBL: CP001720.PE94

CP001720.PE94        Location/Qualifiers
FT   CDS_pept        103104..106628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0096"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: dvl:Dvul_0348
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61059"
FT                   /db_xref="GOA:C8W2Q3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q3"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV61059.1"
FT                   /translation="MAKVTKTMDGNEAAAYMSYAFTEVAAIYPITPSSLMAELVDEWSA
FT                   YGKRNIFGQPLKVVEMQSEGGAAGAVHGSLAAGTLTTTYTCSQGLLLMVPNMYKISGEL
FT                   LPGVFHVTARAIAGHALSIFGDHQDVMACRPTGFAILASSSVQEAMDMAGVAHLSAIKG
FT                   RMPFMHFFDGFRTSHEIQKIEVINYEDMAKLVDYEALKEFKSRGLNPEHPVVRGSAQNP
FT                   DIYFQGKEAANSYYQKVPSIVEGYMQEIGKITGRQYKLFDYYGAADAEYVIVAMGSVCE
FT                   TIEETIDYLLSKGEKVGVVKVRLYRPFSVEHFLAVMPGTVKKIAVMDRTKEHGSVGEPL
FT                   YLDVVNVFYKKENKPLIVGGRYGLGSKDTTPSQIIAVFNNLKQDDPKDRFTVGILDDVT
FT                   YTSLPEEPLVDTSAEGTICCKFWGLGSDGTVGANKSAIKIIGDHTDLYAQGYFAYDSKK
FT                   SGGSTISHLRFGKNPIKSTYLVINSDYTACHNSAYIYKYDVLKGLKKNGTFVLNCQWSQ
FT                   EELEEKLPAKVKRFVAENNINFYIIDAVKIAQEIGLGGHINMIMQSAFFKLANVIPVED
FT                   AVKYLKDSIEKSYGKKGDNIVDMNFAAVDRGIDALVKVNVPADWAGVQDEAEVEQNEPD
FT                   FIKNILRLMVKNEGDSLPVSAFMERVDGSLPVGSSAYEKRGIAVMVPEWQPDNCIQCNQ
FT                   CSFVCPHAAIRPFLLNSEEAAKAPATFITKAAKGKGLEELGLQYRMQVSTLDCTGCGNC
FT                   VETCPAKEKALVLKSADEQNSEQVANWGFAATVSIKDKLLDPKTLKGSQFKQPLFEFSG
FT                   ACPGCGETPYIKLITQLFGDRMMIANATGCSSIYGASSPAIPYTTNSEGKGPSWANSLF
FT                   EDNAEFGFGMYLGVKQTRDKLAGLMKQVVETSDSDVLKEACHEWLAGMNEAEASKAAAS
FT                   KLLAVLEGIDYSGNKAIEEIVEKKDYLVKKSQWILGGDGWAYDIGFGGLDHVLASGENV
FT                   NVLVMDTEVYSNTGGQSSKATPTGAVAKFAASGKKIKKKDMGLMAMSYGYIYVAQIALG
FT                   ANMSQALKAIAEAEAYDGPSLIIAYAPCINHGIKSGMGTSTAEMKKAVAAGYWHLYRYN
FT                   PILKDQGKNPFILDSKEPQDSYKEFLTGEVRYASLQQTFPDIAEKLFEAAEQDSKERLA
FT                   NYKRLAGE"
     atggcaaagg ttacaaagac tatggatgga aatgaagcag ctgcgtatat gtcctatgcc        60
     tttacagagg tagcagcaat ctatcctatt accccgtctt ctttaatggc agagctggtg       120
     gatgagtggt ctgcttatgg taagaggaac atattcggac aacctttgaa agttgtggaa       180
     atgcagtctg agggtggagc cgccggtgca gtgcacggtt ccctggctgc cgggacattg       240
     acgaccacgt atacttgctc acaaggcttg ctgttgatgg ttcccaatat gtataaaatt       300
     tccggcgaac tgcttcccgg cgtttttcat gttacagcca gggcgatagc gggacacgct       360
     ttgtcaattt ttggtgatca ccaggatgta atggcctgtc ggccgaccgg ttttgctatt       420
     ttggcttctt ccagtgtaca ggaagccatg gatatggccg gtgtcgcaca tttatcagct       480
     attaaaggca ggatgccgtt tatgcatttc tttgacggtt tccggacttc ccatgaaatc       540
     caaaaaattg aagtgataaa ttatgaagat atggctaagc tggttgatta tgaggcatta       600
     aaagaattta agtccagggg attaaatcct gagcatcctg tggtaagggg ctcggctcaa       660
     aacccggata tctattttca gggtaaagaa gctgccaaca gttattatca aaaagtacct       720
     tctatagtag aaggctatat gcaggaaatc ggcaagatta caggccgtca atataagctc       780
     tttgattact atggcgcggc tgacgccgag tatgtaatag tagccatggg ttcggtatgt       840
     gaaacaatcg aagaaacaat tgactactta ttgagcaagg gtgaaaaagt tggggttgtt       900
     aaagtacgcc tctaccgtcc tttttcagta gagcactttt tagctgtcat gcctggcacg       960
     gtaaagaaaa ttgctgtaat ggacagaacc aaggaacatg gttctgttgg tgaacccttg      1020
     tatctggatg ttgttaatgt attctataag aaagaaaata agccgctgat tgttggcggt      1080
     cgctatggtc tgggttctaa agataccact ccttcccaaa taatagcagt atttaataac      1140
     ctgaaacagg atgatcctaa ggatcgcttt actgtcggca ttttagatga tgttacttac      1200
     acatcactgc cggaagagcc cctggttgat accagtgctg aaggtactat ttgctgtaaa      1260
     ttctggggtt tgggatcaga cggaacggtt ggtgccaaca agtctgctat taaaattatt      1320
     ggtgaccaca cggacttata tgctcaaggt tattttgcct atgacagtaa gaagtccggc      1380
     ggttcgacta tttctcattt gagatttggg aaaaacccga ttaagtcaac ttatctggta      1440
     ataaattccg attatactgc ctgccataac agtgcttata tttataaata tgatgtactg      1500
     aagggtttaa agaaaaacgg tacttttgta ctcaactgcc agtggagtca ggaagagttg      1560
     gaagaaaaac ttccggctaa ggttaaaagg tttgtagccg aaaacaatat taatttctat      1620
     attattgatg ccgttaagat tgcccaggaa atcggattgg gtggtcacat taacatgatt      1680
     atgcagtcag ctttctttaa attggccaat gtaattccgg tagaagatgc tgttaaatat      1740
     ctgaaagatt ctatagagaa gtcttatggt aaaaaaggcg acaatattgt tgatatgaac      1800
     tttgcggcgg tagatcgcgg tatcgacgct ctggtcaaag ttaatgtacc ggcagattgg      1860
     gccggtgtgc aggatgaagc agaagttgaa cagaatgagc ctgattttat caagaatatt      1920
     ttacgattaa tggttaaaaa cgagggcgac tcccttccgg ttagtgcctt tatggaaaga      1980
     gttgacggca gtttgccggt aggatcttcc gcttatgaaa aacggggtat tgctgtaatg      2040
     gtgccggagt ggcagccgga taattgtatc cagtgcaatc agtgctcttt tgtgtgccct      2100
     cacgcagcca taaggccgtt tttgctgaac agtgaagaag ctgcaaaggc accggcaact      2160
     tttataacta aggctgcaaa aggcaaaggg ttggaggaac tgggactgca gtatcgcatg      2220
     caggtaagca ctctggattg taccggctgc ggaaactgtg tagaaacctg tccggctaag      2280
     gagaaggcct tggttctgaa gtctgcggat gagcaaaaca gcgagcaggt agctaactgg      2340
     gggtttgccg caactgtcag tatcaaggat aaattactcg atcctaagac acttaaaggc      2400
     agccagttta aacagccttt gtttgagttc agcggagcct gtcccggttg cggtgagact      2460
     ccttatataa aacttataac acaattattc ggtgacagga tgatgattgc caatgcgaca      2520
     ggctgttcct ctatttatgg ggccagttct cctgctatac cgtatacaac taattctgaa      2580
     ggcaaaggcc cctcctgggc aaactcactg tttgaagata atgcggaatt tggtttcggc      2640
     atgtatctag gagttaagca gaccagagat aaattggctg gcttaatgaa acaagtagta      2700
     gagacttccg acagcgacgt attaaaagaa gcctgtcatg agtggttggc cggcatgaat      2760
     gaagccgaag cttccaaggc tgccgcgtct aaactgctgg ctgttctgga aggtattgat      2820
     tatagcggca ataaggctat tgaggaaatt gtagagaaga aggattattt ggttaagaag      2880
     tcccagtgga ttctcggcgg tgacggctgg gcttatgata tcggttttgg cggtttggat      2940
     catgtattgg ccagtgggga aaatgtaaat gtattggtaa tggatacaga agtttactcc      3000
     aataccggcg gacagtcttc caaggctact cctaccggag cagttgccaa atttgcggcc      3060
     tcaggcaaaa agattaaaaa gaaagacatg ggcttaatgg ctatgagtta tggctatatc      3120
     tatgtggctc agatagctct gggtgccaac atgagccagg ccttaaaggc tattgcagaa      3180
     gctgaagcct atgacggtcc gtccttaatt attgcttatg ctccttgcat taaccatggc      3240
     atcaagtccg gtatgggtac cagtacagca gaaatgaaaa aggctgtggc agcgggctac      3300
     tggcaccttt acagatataa tccgatactt aaagatcagg gtaaaaaccc gttcattctg      3360
     gattctaagg agcctcaaga ttcttacaag gagttcctta ccggtgaggt acggtatgct      3420
     tccttgcagc agactttccc ggatattgcg gagaaactgt ttgaagcggc tgaacaagac      3480
     tctaaggaga gattggccaa ttataaacgc ttggccggag aataa                      3525
//

If you have problems or comments...

PBIL Back to PBIL home page