(data stored in ACNUC7421 zone)

EMBL: CP001720.PE98

CP001720.PE98        Location/Qualifiers
FT   CDS_pept        109028..109729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0100"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: geo:Geob_2152 dTMP kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61063"
FT                   /db_xref="GOA:C8W2Q7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q7"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ACV61063.1"
FT                   /translation="MRGVFIVFEGIDGSGKTTQINILYKNLLQHNRIKNQPAGSEYVLL
FT                   TREPGGTATSELIRNILLNPANDKLCARTEALLYAAARAQHVEERIRPALSSGKIVICD
FT                   RFIDSSLAYQGYGRGQDLSFLHNLNQLAAGGLKPDLTILLDLPVGAALKRLNNRQVSGI
FT                   EKDRLESEAVSFYERVREGYLKIAGTGIDNNSAGSGGYLVVNADQELNKVSDRIIDGVG
FT                   NCLPKLAVQFR"
     atgcgcgggg tttttattgt ttttgaaggg atagacggtt ccggtaaaac aacacagatt        60
     aatattttat ataaaaattt gcttcagcat aatagaatta aaaaccaacc ggcaggttct       120
     gaatatgtac tattgaccag ggaacccgga ggcactgcta ccagtgagtt aatcaggaac       180
     atattgttga atcctgccaa tgacaagctg tgtgccagaa ctgaagcact tttgtatgct       240
     gcggccagag cacagcatgt ggaggaaagg attaggcccg ctttatccag tggcaaaata       300
     gttatatgtg accgttttat tgactcttca ctggcttacc aggggtacgg gcggggacag       360
     gacctgagct ttttgcataa tcttaatcaa ctggctgcag gtgggttaaa gccggattta       420
     acgatattat tggatctgcc agtgggcgca gctttaaaac gcttgaacaa ccgccaggtt       480
     agcggtatag aaaaggatcg cttggagagt gaagctgttt ctttttacga aagagtgaga       540
     gaaggctatt taaaaattgc aggtaccggt atagataata acagtgccgg aagcggcggt       600
     tatcttgttg taaatgcaga tcaagagtta aataaagtaa gtgaccggat tatagacggt       660
     gtgggtaact gccttccaaa gctagcggta cagtttagat aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page