(data stored in ACNUC7421 zone)

EMBL: CP001720.PE99

CP001720.PE99        Location/Qualifiers
FT   CDS_pept        109875..110951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0101"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: geo:Geob_2151 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61064"
FT                   /db_xref="GOA:C8W2Q8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q8"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACV61064.1"
FT                   /translation="MLLSASQDIKTLHLLDNCYPKRSFSMHMFSQIIGHKSLIRGLEQA
FT                   VATGRVAHAYLFSGQHGVGKKTTALALSASLLCDFNRSGDACGKCTSCRQLVNGNHPDL
FT                   HIISPDGASIKIEQIRDLQQKARYKSYQNKHQIFIIDQAEGMTREAANCFLKILEEPPE
FT                   QTVFILISAEPELLLPTVISRCQPMSFKDLGLEEISSLLIQLSGVNQEKAGLAAQMARG
FT                   SIGRALSYFNDDQQYKLRELVIRLSQSTRRSAISLLLQEVEELLGKKVNIFEMLEMLSL
FT                   WYRDLLIWKSSHNEKLVFNRDKLDVIDTEAEHYTLEKLVNALEMSEMTKYKLMRNANRR
FT                   AALDVLLLSLTRLGRGEH"
     ttgttattgt cggcgtctca ggatataaaa acattgcatt tgcttgataa ctgttaccct        60
     aaaaggagtt tttccatgca catgttttcc caaataatag ggcacaaaag tttgattaga       120
     ggactggaac aagctgtagc aacaggaagg gtggcccatg cttatctctt ttccggacag       180
     catggagtag gtaaaaaaac taccgcactc gctttgtcag cctcacttct ttgtgatttt       240
     aaccggagtg gggatgcttg cggcaaatgt acaagttgcc gtcaactggt gaatggcaac       300
     caccctgatc tgcatattat atctcctgac ggagccagta taaaaattga acagatcaga       360
     gacttgcagc agaaagccag gtacaagtcc tatcaaaata agcaccagat ttttataatt       420
     gaccaggcgg aaggaatgac cagagaagct gctaactgct tcctgaagat tttggaggaa       480
     ccgccggagc aaactgtatt tatcttgatt tcagctgagc cggaattgct gctgccgacg       540
     gtaatttcca gatgtcagcc gatgtctttt aaagatcttg gtttggagga gatttcctca       600
     ttgctcatcc aattatccgg tgttaatcag gaaaaagccg gtttagctgc gcagatggca       660
     cgaggcagta ttggcagagc tttaagctac tttaatgacg atcaacaata taaactaaga       720
     gagctggtta tacgcttgtc ccaaagtacc aggcgctcgg ccatttcttt gttgttacaa       780
     gaagttgaag agcttttggg taaaaaagta aatatctttg aaatgttgga aatgctttca       840
     ttatggtatc gggatttatt aatttggaag tcctcacata acgaaaagct cgtttttaac       900
     cgggacaagc tggatgtaat agatacggaa gcagagcatt atactttgga aaaactggta       960
     aacgctttgg aaatgtctga gatgaccaaa tataaattaa tgcgcaacgc taaccggcgt      1020
     gcggcactgg atgtgctgct gctgagtttg acccgtttag gaagagggga gcactga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page