(data stored in ACNUC30630 zone)

EMBL: CP001737.PE10

CP001737.PE10        Location/Qualifiers
FT   CDS_pept        13125..14000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0010"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   ppw:PputW619_2664 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76448"
FT                   /db_xref="GOA:C8XHV7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV7"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ACV76448.1"
FT                   /translation="MGSIFTTIALPVALAIVMFGLGLGLTRQDFGLILKHPKVTLVALA
FT                   CQVIVMPVVCFGLVLAFGLPPELAVGMMLLAAAPGGTSANLVSHVFRGDVALNISLTAV
FT                   NSVLALVTLPVMVNLSAQYFDVQSVQMGSPFQVVRDVFVIVLLPVILGMLTRAWRPGWA
FT                   QRMDRPVRLVSAVILVLVLLGAIAANWDLLRVEFGRLAMITVLFCLISLSVGLLVPRWF
FT                   GATRRQSIATSFEIGIHNATLAIVVAQTVLNSVELSLPAAVYGVLMVPLALGFGALLRT
FT                   RVRLRPDPVV"
     atgggttcga tcttcaccac gatcgctctg ccggtcgccc tggccatcgt catgttcgga        60
     cttggcctgg ggctgacccg gcaggacttc gggctcatcc tcaaacaccc caaggtcacg       120
     ctggtcgccc tggcctgtca ggtgatcgtg atgccggtgg tctgtttcgg tctggtgctg       180
     gcgttcggcc tgccgccgga actggccgtc ggcatgatgc tgctggccgc agcgccgggc       240
     gggacctcgg ccaacctggt cagccacgtc ttccgcggtg acgtcgccct caacatcagc       300
     ctgaccgcgg tcaattcggt gctggccctg gtcaccctgc ccgtcatggt caacctgtcc       360
     gcgcagtact tcgacgtgca gagcgtgcag atgggttcgc cgttccaggt ggtccgggac       420
     gtcttcgtga tcgtcctgct gccggtgatc ctgggcatgc tcacccgggc ctggcgtccg       480
     ggctgggcgc aacggatgga ccgtccggtg cggctggtct cggccgtcat cctggtgctc       540
     gtgctgctcg gcgccatcgc cgcgaactgg gacctgctcc gggtcgagtt cggccggctc       600
     gccatgatca ccgtgttgtt ctgcctgatc agcttgagcg tggggctgct ggtcccgcgc       660
     tggttcggcg ccacccgccg gcagtcgata gccacctcgt tcgagatcgg catccataac       720
     gccaccctgg cgatcgtcgt cgcgcagacg gtcctgaact cggtcgagct ctccctgccg       780
     gccgccgtct acggcgtgct gatggtgccg ttggccctgg gtttcggtgc cctgctgcgc       840
     acccgcgtgc ggctgcgccc cgatcccgtc gtctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page