(data stored in ACNUC30630 zone)

EMBL: CP001737.PE100

CP001737.PE100       Location/Qualifiers
FT   CDS_pept        113701..114483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0104"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   rpt:Rpal_4080 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76538"
FT                   /db_xref="GOA:C8XIV1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV76538.1"
FT                   /translation="MATVDEDLRDQVRDRYARAALAVTAPAGAADCCGGGCGATVLDDP
FT                   DAPFGAGRYEPEQTSELPPEAVLASLGCGNPLAVAELRAGERVLDLGSGGGIDVLLSAK
FT                   RVGPTGFAYGLDMTDEMLVLARANAAKAGAANVEFVKGHIEDIPLPDAAVDVVISNCVI
FT                   NLSVDKPAVLAEMFRVLAPGGRIGISDVVAEDHLSVADRAERGSYVGCIAGALSRQEYL
FT                   DGLAAAGFVDADVTFTHEAAPGLHAAIIRARTPRPAGS"
     atggcgacgg tggatgagga tctgcgggat caggtgcggg accggtacgc gcgggcggcg        60
     ctggcggtga ccgcgccggc cggggcggcc gactgctgcg gcggcgggtg cggggcgacc       120
     gtgctggacg acccggacgc gccgttcggg gccggccggt acgagccgga gcagacctcg       180
     gagctgccgc cggaggcggt gctggccagc ctgggctgcg ggaacccgct ggccgtcgcc       240
     gagctccggg ccggggagcg ggtgctcgac ctcggctcgg ggggcgggat cgacgtgctg       300
     ctgtccgcga agcgggtcgg gccgacgggg ttcgcctacg ggctggacat gaccgacgag       360
     atgctggtgc tggccagggc gaacgcggcc aaggccggcg ccgccaacgt ggagttcgtc       420
     aaggggcaca tcgaggacat cccgttgccg gacgccgcgg tcgacgtggt gatctccaac       480
     tgcgtgatca acctgtccgt ggacaagccc gcggtgctgg ccgagatgtt ccgggtgctg       540
     gccccgggtg gtcggatcgg catctccgac gtggtcgccg aggaccatct cagcgtcgcc       600
     gaccgggccg aacgcggctc ctacgtcggc tgcatcgccg gtgcgctgtc ccgccaggag       660
     tacctggacg ggctggccgc cgccggcttc gtcgacgccg acgtgacctt cacccacgag       720
     gccgcaccgg ggctgcacgc ggcgatcatc cgggcccgta cgccccggcc ggccggctcg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page