(data stored in ACNUC30630 zone)

EMBL: CP001737.PE110

CP001737.PE110       Location/Qualifiers
FT   CDS_pept        127039..127602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: seh:SeHA_C3506 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76548"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76548.1"
FT                   /translation="MTGFLGKWLKMPTLGERLRAQGVRDDLVRAAERTAFGRQTDRELP
FT                   RLAELLTDQEVVIQLVEGRWNKKMGLFALTSRRVLFVPGGDAPYGAEVPLTEVVSVESG
FT                   KAKGMGTVEVRTESSRLQVDQILGTQADTFAANTRAAMTPAGDGPAVYRDPLQELAELR
FT                   ALHAAGAVSDEEFAQRKIRLMDEI"
     atgaccggat tcctcggcaa gtggctcaag atgccgacgc tgggcgagcg gctgcgcgct        60
     cagggggtgc gcgacgacct ggtgcgggcg gccgagcgca ccgcattcgg gcggcagacc       120
     gaccgggagc tgccccggct ggccgagctg ctcaccgacc aggaggtggt catccagctg       180
     gtcgagggtc gctggaacaa gaagatgggc ctgttcgccc tgacctcccg gcgggtgctg       240
     ttcgtgcccg gcggcgacgc gccctacggg gccgaggtgc cgctgaccga ggtggtgtcg       300
     gtggagtcgg gcaaggccaa gggcatgggc actgtcgagg tccggaccga gtcgtcccga       360
     ctgcaggtcg atcagatcct gggcacccag gcggacacgt tcgcggccaa cacccgggcg       420
     gcgatgacgc cggccggcga cgggccggcg gtctaccggg acccgttgca ggaactggct       480
     gaactgcgcg ccctgcacgc cgccggtgcc gtcagcgatg aggagttcgc ccagcgcaag       540
     atccggctga tggacgagat ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page