(data stored in ACNUC30630 zone)

EMBL: CP001737.PE124

CP001737.PE124       Location/Qualifiers
FT   CDS_pept        143350..145845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0128"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; DNA ligase D, 3'-phosphoesterase domain protein;
FT                   DNA polymerase LigD, ligase domain protein; PFAM: ATP
FT                   dependent DNA ligase; ATP dependent DNA ligase domain
FT                   protein; DNA primase small subunit; KEGG: rpi:Rpic_0501 DNA
FT                   ligase D"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76562"
FT                   /db_xref="GOA:C8XIX5"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX5"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ACV76562.1"
FT                   /translation="MAADSATVEVDGHRIALTHLRKVLYPASGTTKSEVIAYFAEVAHA
FT                   MIPHLADRPVTRKRWPDGVTTAPFFHKDLPKGTPSWVPRRTIRHSDGPKDYPLVDSPAT
FT                   LAWLGQIAALELHVPQWTFGSAAASVAGGDGEITEAVFDAVHPNRLVFDLDPGPGVELV
FT                   DCAHVARAVRERMGGAALVPVTSGSKGIHLYAWLDGSLTSDDASAYAREIAEAIEQDMP
FT                   DLVVSRMAKSLRRGKVFIDWSQNNGSKTTIAPYSLRGREHPTVAAPRTWEELADPELRH
FT                   LEYTEVLELLAAAPDPMQGLEDGDNDGAETRGGSRRRGRGPDTKLDTYRSMRSADKTPE
FT                   PVPEPGLLPQGDDDTFVIQEHHARRLHYDFRLERDGVLVSWAVPKGVPESTGRNHLAVH
FT                   TEDHPMDYADFAGEIPHGEYGGGTVSIWDRGTYATEKWREDEVIIVLHGGKARGRYALI
FT                   RTGGKNWLMHRMKDQSPQPKQYDDHRPATPTAPVTARPAPARSTRPEPPKDLRPMLATA
FT                   GSVEDVADERRWRFEGKWDGIRAIATVGPSGLTLRSRLGNDVTPTYPELAVLAELLDGH
FT                   SAVLDGEIVALQDGRTSFHEMQKRMNVQRARDVARVMRDVPVQFWIFDVLNLDGISLLD
FT                   KRYDDRRRILEALPLTGGVCLVPPQLAGPARDALRGSADRQWEGIVAKLGDSTYQPGRR
FT                   SHSWLKIKNFLDLEVVVVGWSPGTGRREGTVGALLLAVPDGAGGLRYAGKVGTGFTDAI
FT                   LDQLMQALAPLRADRSAVADTIPRADAAGAIWVRPELVGEVKYGQWTPERRLRATSWRG
FT                   LRPDKTVADLIAGSAPPPS"
     atggccgcag acagcgcgac ggtcgaggtg gacggtcacc ggatcgcgtt gacccatctg        60
     cgcaaggtgc tctatccggc cagcggcacc accaaatcgg aggtgattgc ctacttcgcc       120
     gaggtcgcgc acgcgatgat cccgcacctg gccgaccgtc cggtgacccg caaacggtgg       180
     cccgacgggg tcaccaccgc gccgttcttc cacaaggacc tgcccaaggg cacgccgagc       240
     tgggtgccgc ggcggaccat ccggcattcc gacgggccca aggactaccc gctggtcgac       300
     tcaccggcca cgctggcctg gttgggacag atcgccgccc tggaactgca tgtgccgcaa       360
     tggacctttg ggtccgcggc ggcgtcggtg gccgggggtg atggtgagat caccgaggcc       420
     gtcttcgatg ccgtgcatcc gaaccggttg gtgttcgacc tcgatccggg accgggggtc       480
     gagctggtcg actgcgcgca cgtcgcccgg gccgtccgcg agcggatggg cggcgcggcg       540
     ctggtcccgg tcaccagtgg ttccaagggg atccatctct acgcctggct ggacgggtcg       600
     ctgacctcgg acgacgcttc ggcctacgcg cgggagatcg ccgaggcgat cgagcaggac       660
     atgccggatc tggtggtctc ccggatggcc aagtcgctgc gccgcgggaa ggtgttcatc       720
     gactggtcgc agaacaacgg ctccaagacc accatcgcgc cctactcgtt gcgcgggcgg       780
     gagcacccca ccgtggcggc cccacggacc tgggaggagc tggccgaccc cgaactgcgg       840
     cacctggagt acaccgaggt gctcgaactg ctggccgccg cgccggatcc catgcagggc       900
     ctggaggacg gcgacaacga cggcgccgag actcgcggcg gctcccggcg gcgggggcgc       960
     gggccggaca ccaagctgga cacctaccga tccatgcggt cggccgacaa gaccccggaa      1020
     ccggtgcccg agccgggcct gctgccgcag ggagacgacg acacgttcgt catccaggag      1080
     catcacgcgc ggcgactgca ctacgacttc cggctcgaac gcgacggggt gctcgtctcc      1140
     tgggccgtgc cgaagggggt gccggagagc accggtcgca atcatctggc cgtgcacacc      1200
     gaggaccatc cgatggacta cgccgacttc gccggcgaga tcccgcacgg cgagtacggc      1260
     ggcggcacgg tcagcatctg ggaccgcggc acctatgcca ccgagaaatg gcgtgaggac      1320
     gaggtcatca tcgtgctgca cggcggcaag gcccgcggcc gctacgcgct gatccgcacc      1380
     ggtggcaaga actggctgat gcaccggatg aaggaccaga gcccccagcc caagcagtac      1440
     gacgaccacc gtccggccac gcccaccgcc ccggtcaccg cccggccggc cccggcccgg      1500
     tcgacccggc ccgagccgcc gaaggatctg cggccgatgc ttgccaccgc cggctcggtc      1560
     gaggacgtgg ccgacgagcg gcgctggcgg ttcgagggca agtgggacgg tatccgggcc      1620
     atcgccaccg tcgggccgtc gggattgacc ctgcgcagcc ggctcggcaa cgacgtcacc      1680
     cccacctatc ccgagctggc cgtgctggcc gagctgctcg acgggcacag cgcggtgctc      1740
     gacggtgaga tcgtcgccct gcaggacggg cggaccagct tccacgagat gcagaagcgg      1800
     atgaacgtgc aacgggccag ggacgtggcc cgggtgatgc gcgacgtgcc ggtgcagttc      1860
     tggatcttcg acgtgctcaa cctggacggc atctccctgc tggacaagcg ctatgacgat      1920
     cgccgccgga tcctggaggc gctgccgttg accggcgggg tctgcctggt gccgccgcag      1980
     ctggccggtc cggcgcggga tgcgctgcgc ggcagcgccg accggcagtg ggagggcatc      2040
     gtcgccaagc tcggcgattc gacctaccag cccggccgcc gctcccactc ctggctcaag      2100
     atcaagaact tcctcgacct ggaggtggtg gtcgtcggct ggtcacccgg caccggtcgc      2160
     cgggagggga ccgtgggggc gctgctcctg gccgtcccgg acggcgccgg aggcctgcgc      2220
     tacgccggca aggtgggcac cggcttcacc gatgcgatcc tggaccagct gatgcaggcg      2280
     ctcgccccgc tgcgcgccga ccgctcggcc gtcgccgata ccatcccgag agccgatgcg      2340
     gccggagcga tctgggtccg ccccgaactc gtgggcgagg tcaagtacgg ccagtggacc      2400
     cccgagcgcc ggttgcgcgc caccagctgg cgaggcctgc ggccggacaa gacggtcgcc      2460
     gacctcattg ccggctccgc cccgccccct tcctga                                2496
//

If you have problems or comments...

PBIL Back to PBIL home page