(data stored in ACNUC30630 zone)

EMBL: CP001737.PE125

CP001737.PE125       Location/Qualifiers
FT   CDS_pept        complement(146034..146342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0129"
FT                   /product="protein of unknown function DUF1272"
FT                   /note="PFAM: protein of unknown function DUF1272; KEGG:
FT                   bbt:BBta_0568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76563"
FT                   /db_xref="InterPro:IPR010696"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX6"
FT                   /inference="protein motif:PFAM:PF06906"
FT                   /protein_id="ACV76563.1"
FT                   /translation="MALELRPNCEGCDKDLPPAATDAMICSYECTWCSACVDRLRNVCP
FT                   NCGGGFVPRPIRPATEWRPGLSVAQRPASTRRVHMSFSWVQAQELSAALAGIDPAAR"
     atggccctcg aactgcgacc caactgcgag ggctgcgaca aggatctgcc gccggccgcg        60
     accgacgcca tgatctgcag ctatgaatgc acctggtgct ccgcgtgcgt cgaccggttg       120
     cgcaatgtct gccccaactg cgggggcggc ttcgtgcccc ggccgatccg gcccgccact       180
     gaatggcgac cgggcctgtc cgtggcccaa cgcccggcct cgacccgtcg ggtgcacatg       240
     tcctttagct gggtgcaggc gcaggagctc tcggccgcgc tggccggcat cgacccggcc       300
     gcccggtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page