(data stored in ACNUC30630 zone)

EMBL: CP001737.PE130

CP001737.PE130       Location/Qualifiers
FT   CDS_pept        complement(148908..150110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0135"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: scl:sce8961
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76568"
FT                   /db_xref="GOA:C8XIY1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY1"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACV76568.1"
FT                   /translation="MRVLISGAGIAGPSLAWWLQRYGFACTVVERSPTLRTEGQNVDIR
FT                   GAAREVVRRMGLDDEVAARSTGEQGTRFIDGAGHSVAEFPVTHSDTEGATAEREILRGQ
FT                   LASLLYEQTRGAADYRFGHRIAEVRDGEREVTVSFDQGGSESFDLVVLAEGVNSRSRDS
FT                   IVNTAITERSLGLTIAYYSVERSAADDDWWRWYNALGGRTISLRPDNLGRIRVSLSFLS
FT                   DARVDSDPDLGSPKDELTERFRDAGGPAGRVLAGLADADDLYVERLRQIRADRWSNGRT
FT                   VLLGDAAWCATPVSGMGTSLAVVGAYVLAGELAAHVHHQDGLAAYERVMRPYVDQAQDL
FT                   PPGTPRLAHPRSRPGLAAFRTALRLAGSPAFAPVRRRMFAPPADRLQLPDFRHLETTRS
FT                   S"
     atgcgagttc tcatctccgg cgccggcatc gccggcccga gcctggcctg gtggctgcag        60
     cgatacggat tcgcgtgcac cgtcgtcgag cggtccccca ccctgcgcac cgagggtcag       120
     aacgtcgata ttcgcggcgc agcccgcgag gtggttcggc ggatgggtct ggacgacgag       180
     gtggccgcgc gaagcaccgg cgagcagggc acccgcttca tcgacggcgc cggccactcg       240
     gtggccgagt tcccggtgac gcattcggac accgagggcg ccaccgccga gcgggagatc       300
     ctgcgcgggc aactggcgtc tctgctgtac gagcagaccc ggggcgccgc ggactaccgg       360
     ttcggccatc gcatcgccga ggtacgcgac ggcgagcggg aggtgaccgt ctccttcgat       420
     cagggcgggt cggagtcgtt cgacctcgtc gtgctcgccg agggcgtcaa ttccaggagc       480
     cgggactcca tcgtcaatac ggccatcacc gaacgatcgc tgggcctgac catcgcctac       540
     tactcggtcg agcgcagcgc cgccgacgac gactggtggc gctggtacaa cgcgctcggt       600
     ggccgcacga tcagcctgcg gccggacaac ctcgggcgca tccgggtgtc cctgtcgttc       660
     ctgtccgacg cccgggtcga ctccgatccg gacctagggt cgccgaaaga tgaactgacc       720
     gaacgcttcc gggacgccgg cgggcccgcc ggacgggtcc tggccggact ggccgacgcc       780
     gacgatctgt acgtggagcg gctgcgccag atccgggccg accgctggtc gaacggacgg       840
     accgtgctgc tcggcgacgc cgcctggtgc gccaccccgg tgagcggcat ggggaccagc       900
     ctggccgtcg tcggcgccta cgtgctggcc ggcgagttgg ccgcgcacgt gcatcatcag       960
     gacggtctgg ccgcgtacga acgggtgatg cgcccgtacg tcgaccaggc ccaggatctg      1020
     ccgccgggca ccccacgact ggcgcacccc cgttcgcggc ccggcctggc cgccttccgc      1080
     acggcgctgc gtctggccgg ctcgcccgcg ttcgcgccgg tgcgccggcg gatgttcgcc      1140
     ccacccgcgg atcgcttgca actgcccgac tttcggcacc tggagacgac gcgctcgtcc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page