(data stored in ACNUC30630 zone)

EMBL: CP001737.PE133

CP001737.PE133       Location/Qualifiers
FT   CDS_pept        151150..152610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0138"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: kpe:KPK_0932 cobyric acid
FT                   synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76571"
FT                   /db_xref="GOA:C8XIY4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY4"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ACV76571.1"
FT                   /translation="MLARDLQARGLLIAGTSSDAGKSLVTAGICRFLARQGLRVAPFKA
FT                   QNMSNNSMVCADGSEIGRAQYLQAQAAGAVPESAMNPVLLKPGSDRRSFVVVRGRPAGT
FT                   LESGEFASGRRHLAQAAFAAYRELAGRYDVIVCEGAGSPTEINLRAGDYVNMGLAQEFS
FT                   LPVVVVGDIDRGGVFASLYGTVALLDAADQALIRGLIINKFRGDVDLLRPGLDRIAQLT
FT                   GVPVLGVLPWLTEVWLDGEDTLQVGRWGAPIGGPEPRLRVAALRFPRLSNVTDLDALAC
FT                   EPGVEVTMTADPGTIRAADLVVLPGSRATVADLTWLHASGLADAVRQAAGRGTPVLGIC
FT                   GGFQMLARTIDDPVESGAGPVSGLGLLPVDVAFAPDKRLGTPAGDWQGHQVRGYEIHHG
FT                   VATVAPGGGDESFLGGVRVGSVWGTMWHGAFENDDFRRAWLRTATEGRFHADAAAPGFG
FT                   ARREAMLDRLADAVAEHLDTDALLALTR"
     gtgctggctc gtgaccttca agcccgcggc ttgctcatcg ccggtacctc ctcggacgcc        60
     ggaaagtcgc tggtgacggc cggcatctgc cggttcctgg cccggcaggg gctgcgggtt       120
     gcgcccttca aggcgcagaa catgtcgaac aactcgatgg tctgcgcgga cggcagcgag       180
     atcggccggg cgcagtacct gcaggcccag gcggccggcg cggtgcccga gtcggcgatg       240
     aaccccgtgc tgctcaagcc cggctcggac cggcgttctt tcgtcgtggt ccggggtcgc       300
     ccggccggca cgctggaatc cggtgagttc gcttccggcc gcagacatct cgcccaggca       360
     gcgttcgccg cctaccgcga gctggccggg cgttacgacg tcatcgtctg cgagggcgcg       420
     gggtcgccca ccgagatcaa tctgcgcgcc ggcgactacg tgaacatggg cctggctcag       480
     gagttttccc tgcccgtggt ggtggtcggg gacatcgacc ggggcggcgt cttcgccagc       540
     ctctacggca ccgtcgccct gctcgacgcg gccgaccagg cgctcatccg ggggttgatc       600
     atcaacaaat tccgcgggga cgtcgacctg ctgcggccgg gcctggaccg gatcgcccag       660
     ctgaccgggg tgcccgtgct cggcgtgctg ccctggctga ccgaggtgtg gctggacggt       720
     gaggacacgc tgcaggtcgg ccggtggggt gccccgatcg gtgggcccga gccgcggctg       780
     cgggtcgccg ccctccgctt cccccggctg tccaacgtca ccgacctcga cgcgctcgcc       840
     tgcgagcccg gggtcgaggt gacgatgacc gccgatcccg gcacgatccg ggccgccgat       900
     ctggtggtcc tgcccgggtc ccgcgccacc gtggcggacc tgacctggtt gcacgccagc       960
     ggactggccg acgcggtccg gcaggcggcc gggcggggca cgcccgtgtt gggcatctgc      1020
     ggcggcttcc agatgctcgc ccggaccatc gacgacccgg tcgagtccgg cgccgggccg      1080
     gtgtccgggc tggggttgct gccggtcgac gtcgcgttcg ccccggacaa gaggctgggc      1140
     accccggccg gcgactggca ggggcaccag gtccgcgggt acgagatcca ccacggggtg      1200
     gccactgtcg cgccgggcgg cggggacgag tctttcctgg gcggggttcg ggtcggctcg      1260
     gtctggggca cgatgtggca cggtgcgttc gagaacgacg acttccgtcg agcctggctg      1320
     cggacggcca ccgagggacg attccacgcg gacgccgcag ctcccggctt cggggcccgg      1380
     cgcgaggcca tgctggaccg gctggccgat gcggtggccg agcacctgga caccgacgcg      1440
     ctgttggcgt tgacgcgctg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page