(data stored in ACNUC30630 zone)

EMBL: CP001737.PE144

CP001737.PE144       Location/Qualifiers
FT   CDS_pept        complement(165052..165669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0149"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: aeh:Mlg_0745 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76582"
FT                   /db_xref="GOA:C8XIZ5"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ5"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0745"
FT                   /protein_id="ACV76582.1"
FT                   /translation="MEPTSHVSVDVLVLRYDRALRQLRLGLHERTLEPFAGWPALPGVL
FT                   LLRGERIRDAAARALAKVQLTARGSGQLITFDEPSRDPRGPTLSVATWAVTDDIGTARW
FT                   SGWDERPPLAFDHDRIVTDCRPLLAGMLWRDPSFTRLLTGAEFPVTDALALHQALTGAA
FT                   PDRGNLNRTLATIPGLHRTDRQASTGRGRPSTIWAWSPSPTP"
     gtggagccga cctcgcacgt ctcggtggat gtgctggtcc tgcgctacga ccgggcgctc        60
     cgccagttgc ggctggggct gcacgagcgc actctcgagc cgttcgccgg gtggccggcc       120
     ctgcccgggg tgttgctgct gcgcggtgag cggatccggg acgcggccgc ccgggcgttg       180
     gccaaggtgc agctgacggc ccgcggatcc ggccagctga tcaccttcga cgagccgagc       240
     cgcgatcccc gcggccccac cctgtccgtg gccacctggg cggtcaccga cgacatcggc       300
     accgcccggt ggtccgggtg ggacgagcga ccaccgctgg ccttcgacca cgaccggatc       360
     gtgaccgact gccgccccct gctggccgga atgctctggc gggacccctc gttcacccgc       420
     ctgctcaccg gcgccgagtt ccccgtcacc gacgccctcg ccctgcacca ggccctgacc       480
     ggcgccgccc ccgaccgcgg caatctcaac cgcaccctcg ccaccatccc cggcctgcac       540
     cgcaccgacc ggcaggcctc caccggccgc ggccgcccca gcaccatctg ggcctggtcc       600
     ccctccccca ccccctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page