(data stored in ACNUC30630 zone)

EMBL: CP001737.PE146

CP001737.PE146       Location/Qualifiers
FT   CDS_pept        166793..168019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0151"
FT                   /product="nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein beta-
FT                   component ferrodoxin domain protein; KEGG: msl:Msil_3267
FT                   precorrin-3B synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76584"
FT                   /db_xref="GOA:C8XIZ7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ7"
FT                   /inference="protein motif:PFAM:PF03460"
FT                   /protein_id="ACV76584.1"
FT                   /translation="MTSRADPDRCPGVLRPHAAQDGALLRIRIPGGRIGAAALRALSQA
FT                   STEYADGDVGLTSRANLQLRAVATTADDTVAPGLVDALATAGLLPHPTHDRVRSIACSP
FT                   LTGLIGGHADLRPLIDELDAALCAAPELAALPGPFRFGLDDGRGDIGVDADLSAQALDA
FT                   THARIWVGGLSGPRVPLPEVVPTLIELAHRFVRQCATGRPAWHVRELPRGGAELLAGPE
FT                   VTPAARLGPGAPAPLGALAQADGRATVSVLAPLGRLTPAQAGALADAANGGELVVTPWR
FT                   GVLVPDLDPAAAALVIDTLIAVGLVADGGSPWRGVTACAGAPRCARGTGDTEALARQVV
FT                   AASTRSVSAGPVHVAGCARSCGRPSVAHTLAVIDRRRVHIQGPADPADDQPLDHAAAAV
FT                   AATRAGASR"
     atgaccagtc gtgccgatcc cgaccgctgc cccggggtgc tccggccgca cgcggcgcag        60
     gacggggcgc tgctgcggat ccgcatcccc ggtggccgga tcggggccgc cgcgctgcgg       120
     gccttgagcc aggcgtcgac cgagtacgcc gacggggacg tcgggctgac ctcccgggcc       180
     aacctgcagc tgcgggccgt ggcgacgacg gccgatgaca ccgtggcgcc cggtctggtc       240
     gacgcgttgg ccacggccgg attgctgccg caccccacgc atgatcgggt gcgcagcatc       300
     gcctgctcac cgctcactgg cctgatcggt ggtcacgccg acctgcggcc gctgatcgat       360
     gagctggatg cggcgctgtg cgcggcgccc gagctggccg cgctccccgg gccgttccgg       420
     ttcgggctcg acgacgggcg cggcgacatc ggggtcgacg ccgacctgtc cgcgcaggcg       480
     ctcgacgcga cccacgcccg catctgggtg ggcggccttt ccggtccgcg ggtgccgctg       540
     cccgaggtgg tgccgaccct gatcgagctg gcccatcggt tcgtccggca gtgcgccacc       600
     gggcggcccg cctggcacgt ccgggaactg ccgcggggtg gggccgagct gctggccggg       660
     cccgaagtga cgcccgccgc ccggctgggt ccgggcgctc cggctcccct gggggcgctg       720
     gcccaggccg acggccgggc gacggtgtcc gtgctggccc cgctgggccg gctcaccccg       780
     gcccaggccg gtgcgctggc ggatgccgcg aacggcggcg agctggtggt gaccccgtgg       840
     cggggggtgc tcgtgccgga cctggacccg gcggcggccg ccctggtgat cgacacgctg       900
     atcgccgtcg gcctggtcgc cgacggcgga tcgccatggc gcggcgtcac cgcctgcgcc       960
     ggggccccgc gctgtgcccg cggcacgggg gacaccgagg cattggcccg tcaggtggtc      1020
     gccgcctcga cccgatcggt gtccgcgggg ccggtgcatg tggccggctg cgcccggtcg      1080
     tgtggccggc cgtcggtcgc ccacacactg gccgtcatcg accgccggcg ggtccacatc      1140
     cagggccccg ccgacccggc ggacgaccag ccgctggacc atgccgccgc tgcggtggcc      1200
     gccactcgag ccggagcatc ccgatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page