(data stored in ACNUC30630 zone)

EMBL: CP001737.PE147

CP001737.PE147       Location/Qualifiers
FT   CDS_pept        168016..168663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0152"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   pmy:Pmen_4572 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76585"
FT                   /db_xref="GOA:C8XIZ8"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ8"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ACV76585.1"
FT                   /translation="MTTRPLRRYAYCADGPEIYRESFAIVRAETDLSGIPADARHLAVR
FT                   MVHASGQPDLVQDMRFHPDLVSAGRATLLAGAPLFVDSMMVSAGITRSRLPAGNEVICH
FT                   LRDHRVEQLAAAWGTTRSAAAVSLWGDELEGAVVAIGNAPTALFHLLEWICEGGPRPAA
FT                   IIGVPVGFVGSAESKQALIEHEAGIPYLVVTGRRGGAAIAASAVNALAGGPS"
     atgaccacgc gaccattgcg ccgctacgcc tactgcgcgg acggccccga gatctaccgg        60
     gagtcgttcg cgatcgtgcg ggccgagacc gacctgtccg ggatcccggc cgacgcccgc       120
     cacctggcgg tgcgcatggt gcacgccagt gggcagccgg acctggtgca agacatgcgt       180
     ttccacccag atctggtctc cgccggccgg gccacgctgc tcgccggggc accgctgttc       240
     gtggactcga tgatggtttc ggctggcatc acccggtccc ggctgccggc cggcaacgag       300
     gtgatctgcc atctgcgcga tcaccgcgtc gagcagttgg ccgccgcctg gggcacgacc       360
     cggtcggctg cggcggtctc gttgtggggc gacgagctcg agggggcggt cgtggccatc       420
     gggaacgcgc cgacggccct gttccacctg ctggagtgga tctgcgaggg cggcccgcgg       480
     ccggccgcga tcatcggcgt gccggtcggc ttcgtcggct cggccgaatc caagcaggca       540
     ctgatcgagc acgaggcggg cattccctac ctggtggtga ccggccggcg cgggggcgcg       600
     gccatcgccg cgtcggccgt caacgcgctg gccggaggac cgtcgtga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page