(data stored in ACNUC30630 zone)

EMBL: CP001737.PE155

CP001737.PE155       Location/Qualifiers
FT   CDS_pept        176418..177035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0160"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: met:M446_2429 cob(I)alamin
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76593"
FT                   /db_xref="GOA:C8XJ06"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ06"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ACV76593.1"
FT                   /translation="MPQAQPLVVPADGLTTRQRRNRALLMVHTGDGKGKSTAAFGMALR
FT                   AWNQGWSVGVFQFVKSAKWRIGEQSALEALDGVHAQTGAGGPIEWHKMGSGWSWLRRDA
FT                   DTADDYAAEAAEGWAEIKRRLAAGAHRLYVLDEFTYPMKWGWVDVDDVVATLAGRAEGQ
FT                   HVVITGRAASPRLIEAADLVTEMTKVKHPMDAGQKGQRGIEW"
     atgccccagg cgcaaccgct cgtcgtgccg gccgacgggc tgaccacccg gcagcggcgc        60
     aaccgggcgc tgctgatggt gcacaccggt gacggcaagg gaaagtcgac cgcggcgttc       120
     ggcatggccc tgcgggcctg gaaccagggc tggtcggtcg gggtgttcca gttcgtcaag       180
     tcggccaagt ggcgcatcgg cgagcaatcg gccctggagg cgctggacgg tgtgcacgcg       240
     cagaccggcg ccggcggacc catcgagtgg cacaagatgg gctcgggctg gtcgtggctg       300
     cgccgcgacg ccgacaccgc cgacgactat gccgccgaag cggccgaggg ctgggccgag       360
     atcaaacgcc ggctggccgc cggcgcgcac cggctgtacg tgctggacga attcacctac       420
     ccgatgaagt ggggctgggt cgacgtcgac gacgtggtgg cgacgctggc cggccgggcc       480
     gagggccagc acgtggtgat caccggccgg gccgcgtcgc cccggctgat cgaggcggcc       540
     gacctggtca ccgagatgac caaggtcaag cacccgatgg acgccgggca aaagggccag       600
     cggggcatcg agtggtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page