(data stored in ACNUC30630 zone)

EMBL: CP001737.PE156

CP001737.PE156       Location/Qualifiers
FT   CDS_pept        177040..179586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0161"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; aminotransferase class
FT                   I and II; KEGG: dal:Dalk_0444 cobyrinic acid a,c-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76594"
FT                   /db_xref="GOA:C8XJ07"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ07"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ACV76594.1"
FT                   /translation="MTSLPRVVIAAPASGHGKTTVAAGLMAALVRAGHVVSGHKIGPDY
FT                   IDPGYHALATGRPGRNLDPHLVGEDRLVPLLLHGAAVPRPADIAVVEGVMGLFDGAIGR
FT                   DGFASTAHVATVIDAPVVLVVDVSASARTIGAVVHGLRGFDPAVRVAGVILNKAGSARH
FT                   AQEARDAVERIGVPVLGVLFRDDGISAPSRHLGLVPVAERDDAAVVLDRLAGQIAARID
FT                   LAAVVRIARSAPDLAAAAWAPPPRVPIDGPAPVIAVAGGRAFTFRYAETEELLAAAGCR
FT                   PVVFDPLAGEALPDGTAGLYLGGGFPEVHAAELAGNAALRASITAVIGRGLPTVAECAG
FT                   LLYLCRSVDGAPMLGVIDAAATMTARLTLGYRAAVAPSGSVLAGAGQAVTGHEFHRTTV
FT                   DPGSGATPGWLIDGAGHGFALDPAGTGTPTVHASYLHTHWAGQPELAARFAAAAHAWTG
FT                   SESPTARIRPCPPHTLHPNPPPVTPEPNLLHHGDLEVGPGLLDFAVNVRSAAPPGWLAE
FT                   TIAATIADLGHYPRAQAATEALAWRHGRPAEQVLPTAGGAEAFTLIARALRPRRPVVVH
FT                   PQFTEPEAALRAAGHVVDRVVLRAADGFTLPDGAVPADADLVMIGNPTNPTGVLHPAAR
FT                   LRALLRPGRVVVVDEAFMDAVPGEPETLAADQVPGLLVLRSLTKTWGIAGLRAGYVVGD
FT                   AELIARLAEHQPPWSVSSPALAAITACCADDAVAEAALLASAVDGPRAVLIDGLRRLGL
FT                   SVPGHPATPFVLADTAPVIPSGAPPGWIRDALRERGIAVRRGDTFPGLGPTWIRVAVRD
FT                   AHLIGRLLDTLSDVLTASPHPPNGVDHGKNAVLPGR"
     gtgacgagcc tgccccgggt ggtgatcgcc gccccggcct ccggtcacgg caagaccacc        60
     gtcgcggccg ggctaatggc cgccctggtc cgggccggac acgtggtgtc ggggcacaag       120
     atcgggccgg actacatcga cccgggctac cacgcgctgg ccaccggccg ccccggccgc       180
     aatctcgacc cgcacctggt cggcgaggac cggctggtcc cgctactgct gcacggcgcc       240
     gcggtgcccc gaccggccga catcgcggtg gtcgagggcg tgatgggcct gttcgacggg       300
     gccatcggcc gcgacggctt cgcctccacc gcgcacgtcg ccaccgtcat cgacgccccg       360
     gtggtcctgg tcgtcgacgt gtccgcgtcc gcccgcacca tcggcgccgt cgtgcacggc       420
     ctgcgcggct tcgacccggc ggtgcgggtc gccggggtga tcctgaacaa ggccggctcg       480
     gcccggcacg cgcaggaggc ccgggacgcg gtcgaacgga tcggcgtgcc ggtgctcggc       540
     gtcctcttcc gcgacgacgg gatcagcgct ccctcaaggc atctcgggct ggtgccggtg       600
     gccgaacggg acgacgccgc cgtcgtcctg gaccggctgg ccgggcagat cgcggcccgg       660
     atcgacctgg ccgccgtcgt gcggatcgcc cggtcggcgc cggacctggc tgcggctgcg       720
     tgggcgccgc cgccgcgagt ccccatcgac gggccggcgc cggtgatcgc ggtggccggc       780
     gggcgggcct tcaccttccg gtacgccgag accgaggaac tgctggccgc cgccggctgc       840
     cggccggtcg tcttcgaccc gctggccggt gaggcgctgc ccgatggcac cgccgggctg       900
     tacctgggcg gcggttttcc cgaggtgcac gcggccgagc tggccggcaa cgcggccctg       960
     cgggcgagca tcaccgcggt catcgggcgc gggctgccga cggtggccga atgcgccggc      1020
     ctgctgtacc tgtgccgcag cgtcgacggc gcgccgatgc tgggcgtgat cgacgccgcc      1080
     gcgaccatga ccgcccggct caccctgggc taccgcgctg ccgtcgcgcc gtccggcagc      1140
     gtgctggccg gggccggtca ggccgtcacc gggcacgaat tccaccgcac caccgtcgat      1200
     cccgggtcgg gcgcgacccc gggctggctg atcgacgggg ccgggcacgg cttcgcgctc      1260
     gacccggccg gcaccggcac gccgaccgtg cacgcgtcct acctgcacac ccactgggcc      1320
     gggcagccgg agctggcggc ccggttcgcc gccgccgcgc acgcctggac ggggagtgaa      1380
     tcccctacgg cgcggatccg gccctgcccg ccgcacaccc ttcatccgaa cccgccgccg      1440
     gtcacaccgg agccgaatct gttgcatcac ggtgatctcg aggtcgggcc cggcctgctc      1500
     gacttcgccg tcaacgtccg ctcggccgca ccgcccggtt ggctggccga gacgatcgcg      1560
     gcgaccatcg ccgacctggg ccactacccg cgggcccagg cggcgaccga ggccctggcc      1620
     tggcggcacg gccggccggc cgagcaggtg ctgcccaccg cgggcggcgc cgaggcgttc      1680
     accctgatcg cccgagccct gcgaccccgg cgaccggtcg tcgtgcaccc ccagttcacc      1740
     gagccggagg cggcgttacg ggccgccgga cacgtcgtcg accgggtcgt gctgcgggcc      1800
     gccgacggtt tcaccctgcc cgacggggcc gtgcccgcgg acgccgacct ggtgatgatc      1860
     ggcaacccga ccaaccccac cggcgtgctg catccggcgg cccggctgcg ggccctgctc      1920
     cggcccggcc gggtcgtcgt ggtcgacgag gcgttcatgg acgccgtccc cggggagccg      1980
     gaaacgctgg ctgcggacca ggttccgggg ctgctggtgc tgcggtcgct gaccaagacc      2040
     tgggggatcg ccgggctgcg ggccggctac gtcgtcggcg acgccgagct gatcgcccgg      2100
     ttggccgagc accagccgcc ctggtcggtg tccagtccgg ccctggccgc gatcaccgcc      2160
     tgctgcgccg atgacgccgt ggccgaggcc gcgctcctgg cgtcggcggt cgacgggccc      2220
     cgggcggtgc tgatcgacgg gctgcgccgg ctcggcctga gcgtgcccgg ccacccggcc      2280
     acgccgttcg tgctggccga caccgccccc gtgatcccgt ccggcgcgcc gccgggctgg      2340
     atccgggacg cgctgcggga acgggggatc gcggtccggc gcggggacac cttcccgggc      2400
     ctggggccga cctggatccg cgtcgcggtc cgggacgcgc acctgatcgg ccgcctgctc      2460
     gataccctct ccgacgtact gaccgcctca ccgcaccccc cgaatggagt tgatcatggg      2520
     aagaatgccg ttttgccggg ccgataa                                          2547
//

If you have problems or comments...

PBIL Back to PBIL home page