(data stored in ACNUC30630 zone)

EMBL: CP001737.PE166

CP001737.PE166       Location/Qualifiers
FT   CDS_pept        complement(192290..192832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0171"
FT                   /product="Adenosylcobinamide-phosphateguanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   kpe:KPK_0933 cobinamide kinase/cobinamide phosphate
FT                   guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76604"
FT                   /db_xref="GOA:C8XJ17"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ17"
FT                   /inference="protein motif:PRIAM:2.7.7.62"
FT                   /protein_id="ACV76604.1"
FT                   /translation="MTSTRRTLVTGGVRSGKSRVAENLLADRPAVSYLAPGPVPDRSVD
FT                   PEWADRIDAHRAQRPSHWRTVETTDLARALGQERAAVLIDCLGTWVTAVVDQLGTWDRR
FT                   LAEWQPDFDRQLDDLERAWRSHPGPLVAVTNEVGWGVVPEHRSGRTFRDLLGRVNQRIA
FT                   AASDDVLLVVAGRTLRL"
     gtgacttcga cccgccgcac cctggtcacc ggcggcgtcc gatcgggcaa gtcccgcgtg        60
     gccgagaacc tgctggccga tcgtccggcc gtcagttacc tggcccccgg gccggtcccc       120
     gatcgatccg tcgacccgga gtgggccgac cggatcgacg cccaccgggc gcagcgtcca       180
     tcccactggc gaacggtcga gaccaccgac ctggcccggg cgctcggcca ggaaagggcc       240
     gcggtgctga tcgactgcct gggcacctgg gtgaccgcgg tggtcgacca gctcggcacc       300
     tgggatcggc ggctggccga atggcaaccc gacttcgacc ggcagctcga cgatctcgag       360
     cgggcctggc ggtcccatcc cgggccgttg gtcgcggtga ccaacgaggt cggttggggc       420
     gtggtgcccg agcaccggtc cggccgcacc ttccgcgacc tgctcgggcg ggtcaaccag       480
     cggatcgcgg cggccagcga cgacgtgctg ctggtcgtcg ccgggcggac gctgcggctg       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page