(data stored in ACNUC30630 zone)

EMBL: CP001737.PE168

CP001737.PE168       Location/Qualifiers
FT   CDS_pept        complement(194021..195379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0173"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76606"
FT                   /db_xref="GOA:C8XJ19"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ19"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ACV76606.1"
FT                   /translation="MIESSTRFVGGSVPSTAARLHDRSVRLLVGTAVDYAGVIRAKSVP
FT                   VERLSDFVTAGMGASPSWLAFGVDMSIAFTARFGVVGDLRLRIDPAATTVLESGVAWAP
FT                   ADFCEQDGTPFVGCPRARLRAVVDALGAAGLAARTGTELEFVLTRPDGAARIGPTWQGY
FT                   GARPLLDIAPLLTDLTDSFDGAGMPLEQLHAEYGADQFEISLPPADPLTTADRTVLARL
FT                   LIGRAAARHGCGVSFSPVPFAGGAGNGAHLHLSLTDGEGPLLSGGAGPHGLHPAGGAAI
FT                   AGLIDGLPGVQAVLAGSAVSSTRLRPGNWAGAFACWGLENREAAIRLVAATPGNPHGAS
FT                   VEVKVVDASANPYLAAAALLGSALDGIERQLALPDEVPVNPVELTAERRSALALAADQA
FT                   AALAALDRSSLARRLLGDVVVDGTLAVRRHELQAYSGADPDVVAAAFRQAFSG"
     atgatcgaat cgagcacccg tttcgtcggt ggttccgtcc cgtccaccgc cgcccggctg        60
     cacgaccggt cggtgcggct gctggtcggc accgcggtcg actacgccgg cgtcatccgc       120
     gcgaaaagtg ttccagtgga gagattatcg gacttcgtga cggccggcat gggggcctcg       180
     ccgtcctggt tggcgttcgg cgtcgacatg tccatcgcgt tcaccgcccg gttcggcgtg       240
     gtcggcgacc tgcgcctgcg gatcgacccg gccgccacca ccgtcctgga gtccggggtg       300
     gcctgggcgc cggcggactt ctgcgagcag gacgggacac cgttcgtggg ctgcccgcgg       360
     gcgcggctgc gcgcggtcgt cgacgcgctg ggtgccgccg gcctggccgc ccggaccggg       420
     acggaactgg aattcgtgct gacccgaccc gacggggccg cccggatcgg gccgacctgg       480
     cagggctacg gcgcccggcc cctgctggac atcgccccgc tgctgaccga tctgaccgac       540
     agcttcgacg gcgccgggat gccgttggaa cagctgcacg ccgagtacgg cgccgaccag       600
     ttcgagatct cgctgccccc ggccgacccg ctcaccacgg ccgatcgaac ggtcttggcc       660
     cggctgctga tcgggcgggc ggcggcccgg cacggctgcg gagtctcgtt ctcgccggtg       720
     ccgttcgccg gcggggcggg aaacggtgcg cacctgcatc tctccctgac cgacggcgag       780
     ggaccgctgc tgtccggcgg ggccggaccg cacgggcttc accccgccgg cggggccgcg       840
     atcgccgggc tgatcgacgg cctgcccggc gtgcaggccg tgctggccgg gtcggcggtg       900
     tcctcgacca ggctgcggcc cggcaactgg gccggcgcct ttgcctgctg gggtctggag       960
     aatcgggagg cggcgatccg cctggtggcc gccacccccg gcaacccgca tggcgcctcc      1020
     gtcgaggtga aggtcgtcga cgccagtgcc aacccgtacc tggccgcggc ggccctgctg      1080
     gggtcggccc tggacggcat cgagcggcag ttggccttgc cggacgaggt gccggtcaat      1140
     ccggtcgagc tgaccgccga gcgacgatcc gcgctggccc tggccgccga tcaggcggcc      1200
     gccctggcag ccctggaccg ctcgtcgctg gcccgccggt tgctcggtga cgtcgtcgtc      1260
     gacggcaccc tggccgtgcg gcggcacgag ctgcaggcct actccggggc cgatcccgac      1320
     gtcgtcgcgg ccgccttccg gcaggcgttc agcgggtga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page