(data stored in ACNUC30630 zone)

EMBL: CP001737.PE17

CP001737.PE17        Location/Qualifiers
FT   CDS_pept        complement(19821..21164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0017"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: azc:AZC_1515 amidase; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76455"
FT                   /db_xref="GOA:C8XHW4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW4"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACV76455.1"
FT                   /translation="MNDLVGLGAAFRSGELSPTEHVDDVLARLSGDRLNTVITLNADRA
FT                   RAQASRLADEAAQGHWRGPLHGIAVGVKDLIDVQGLPTRCGSHVLDDAPPADADAPVVA
FT                   ALRAAGAIVVAKMHTQEFAHGPTGDAAATGPAHNPHDPTRITGGSSSGSAAAVAAGYLP
FT                   LALGTDTGCSVRTPAALCGVVGLKPTYGRLSTHGVFPLAESLDHVGFLTTDVAAAQLAW
FT                   SVLGGTADAGARIAGLRVGVLVDDYWRAADPAIDPWATAAVEVLAAAGAEPVAVRTPMI
FT                   EELVAAYPVIVGNEAYTTHAGWLAERGQDYQPLIRERLLGFADRPAREYIGAQRTRHRL
FT                   VAALRAALDGAGGGAGGGGVDVLVLPTTRIRATPIGAPTTRIDGTDVPVRPALLALNSP
FT                   FNLTGWPAVSVPAPVDGLPIGVQVVGVRVAERGVLDVAAALERAWRPA"
     atgaacgacc tcgtcggcct cggggccgcc ttccgctccg gtgagctgtc accgaccgag        60
     cacgtcgacg acgtgctcgc tcgcctgtcc ggggaccggt tgaacacggt gatcaccctg       120
     aacgccgacc gggcccgggc ccaggcgagc cggctggccg atgaggcggc ccaggggcac       180
     tggcgtggcc cgctgcacgg aatcgccgtc ggggtcaagg atctcattga cgtgcagggc       240
     ctgccgacgc gctgcgggtc gcacgtgctc gacgacgcac cgccggccga cgccgacgcc       300
     ccggtggtcg cggcgctgcg ggcggcgggt gcgatcgtcg tcgccaagat gcacacccag       360
     gagttcgcgc acggtcccac cggcgacgcg gccgccaccg ggcccgcgca caacccgcac       420
     gatccgaccc ggatcaccgg gggctcgtcg tccggatcgg cggccgcggt ggccgccggt       480
     tacctgccgc tggcgctggg caccgacacc ggctgcagcg tccggacgcc ggccgcgctg       540
     tgcggcgtgg tcgggctcaa gccgacgtac ggccggttga gcacccacgg ggtgttcccg       600
     ctggccgagt ccctggacca cgtcgggttc ctgaccaccg acgtcgccgc ggcgcagctg       660
     gcctggtcgg tgctgggcgg aaccgcggac gccggggccc ggatcgccgg actgcgggtc       720
     ggcgtgctcg tcgacgacta ctggcgggcg gccgatccgg ccatcgaccc gtgggccacg       780
     gccgcggtcg aggtgctggc cgcggccggc gccgaaccgg tggcggtgcg caccccgatg       840
     atcgaggagc tggtcgcggc ctacccggtg atcgtcggca acgaggccta caccacgcac       900
     gccggatggt tggccgagcg aggacaggac taccagccgc tcatccgcga acggctgctc       960
     ggcttcgccg accggccggc ccgggagtac atcggggcgc agcgcacgcg ccaccggctg      1020
     gtggctgcgc tgcgggccgc gctcgacggc gccggcgggg gggccggtgg gggtggggtc      1080
     gacgtgctgg tgctcccgac cacccgcatc cgggccaccc cgatcggcgc cccgaccacc      1140
     cggatcgacg ggaccgacgt gccggtccgg ccggccctgc tcgccctcaa ttccccgttc      1200
     aacctgaccg gctggccggc ggtgtcggtc ccggcgccgg tggacgggct gccgatcggc      1260
     gtgcaggtcg tcggcgttcg ggtggccgag cgcggcgtgc tggacgtcgc cgcggccctg      1320
     gaacgagcct ggcggcccgc ctga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page