(data stored in ACNUC30630 zone)

EMBL: CP001737.PE172

CP001737.PE172       Location/Qualifiers
FT   CDS_pept        complement(198098..199426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0177"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dde:Dde_2162
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76610"
FT                   /db_xref="GOA:C8XJ23"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ23"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV76610.1"
FT                   /translation="MARESGLNRQILRLAVPALGALLAEPIFLLVDAAIVGHLGVAQLA
FT                   GVGIASVILGTLVGLSVFLAYGTTAQVSRALGAGRPADALTFGIAGLYLAVIIGVAVLA
FT                   VGWPLAPWLIDLFGGTTAVADFGIVFLRWSLLGLPAMLAVLATTGVLRGLQDTRTPLYV
FT                   AGAGAMVNMGLNVLLVYGIGLGVAGSAIGTALTQTAMAAVLVVIVARGARRLGVALTPH
FT                   AGHIRGAGRAGVPLFVRTLTLRAAIIVTTAVAARQGVTVLAAQQVVMSIWNFLALGLDA
FT                   LAIAAQALTGKALGEGDQAAARRFTGVMLRWGVGAGVAIGIVVLLIHTFAGAAFSPDPE
FT                   VRTAVGAALIVVAVSQPLCGWVFVLDGVLIGAGDGVYLAWAGVLTLVVYLPAAWAVAMW
FT                   APGGSAGLVWLWVAFSIVFMGARAVTLGWRYRGDRWLITGAVR"
     atggcgcgcg agtccgggct caaccggcaa atcctgcggc tggcggttcc ggcgctgggt        60
     gcgctgctgg ccgagccgat cttcctgctg gtcgacgcgg cgatcgtcgg tcacctcgga       120
     gttgctcagc tggcgggcgt gggcatcgcc tcggtcatcc tgggcaccct cgtcggattg       180
     tcggtgttcc tggcgtacgg cacgaccgca caggtttccc gggccctggg tgcgggccgt       240
     cccgccgatg cactgacctt cggcatcgcc gggctgtacc tggccgtgat catcggggtg       300
     gccgtgctgg cggtcggctg gccgttggcg ccgtggctga tcgacctctt cggcggcacg       360
     acggcggtgg ccgacttcgg gatcgtcttc ctgcgctggt ccctgctcgg cctgccggcg       420
     atgctcgccg tgctggccac caccggcgtg ctgcgcgggc tgcaggacac ccgcaccccg       480
     ctgtatgtcg ccggggccgg agccatggtc aacatggggc tcaacgtgct gctggtctac       540
     ggaatcgggc tgggcgtggc cggttcggcc atcggcacgg cattgaccca aacggcaatg       600
     gcggccgtgc tggtggtcat cgtggcccgc ggcgcgcggc ggctcggggt cgcgttgaca       660
     ccgcacgccg ggcacatccg cggcgccgga cgggcgggcg tgccgctgtt cgtccgcacc       720
     ctgaccctgc gggcggcgat catcgtcacc accgccgtgg ccgcccggca gggagtcacc       780
     gtgctggccg cgcagcaggt cgtcatgtcc atctggaact tcctggccct gggtctggac       840
     gcgctggcca tcgccgcgca ggcgctgacc ggcaaggccc tcggcgaggg ggaccaggcg       900
     gccgcgcgcc gcttcaccgg ggtgatgctg cggtggggcg tcggggccgg tgtggccatc       960
     ggcatcgtgg tgctgctcat ccacaccttc gccggggccg cgttctcccc cgaccccgag      1020
     gtgcgcaccg ccgtcggcgc ggcgctgatc gtggtcgccg tctcgcagcc gttgtgcggg      1080
     tgggtgttcg tgctggacgg ggtactgatc ggcgccggcg acggcgtcta cctggcctgg      1140
     gccggcgtgc tcacgctggt cgtctacctg ccggcggcgt gggcggtcgc gatgtgggcg      1200
     cccggcggca gcgccggtct ggtctggctg tgggtggcgt tctcgatcgt cttcatgggc      1260
     gcccgggcgg tgaccctggg ctggcggtat cgcggggatc gttggctgat caccggcgcc      1320
     gtccggtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page