(data stored in ACNUC30630 zone)

EMBL: CP001737.PE173

CP001737.PE173       Location/Qualifiers
FT   CDS_pept        complement(199443..200831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0178"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   rle:RL3006 putative L-2,4-diaminobutyrate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76611"
FT                   /db_xref="GOA:C8XJ24"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ24"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACV76611.1"
FT                   /translation="MTDEPGSVADLIRTAAEAVIDYRAGLPHRPVAGPADRAALLAALG
FT                   GPLPAGPTSPDRVIDDLVVAADPGLVATAGPRFFGFVIGGSLPAATAADILAVGWDQVA
FT                   FNAISSPAASVVEEVAGGWCKQLLGIPASASVGFGTGAQSANTVGLATARHQVLAAAGW
FT                   DVERDGLAGSPRVRVVASVERHATVDRSLRLLGLGNASVRPVAAGPQGAIDINDLAKVL
FT                   ADEPTMPTIVVLQTGNVNTGACDDLRAAIGLARTVEHSWVHVDGAFGLWAAACPQTRAL
FT                   TDGIELADSWCTDAHKWLNVPYDCGLVFCADPSAHVAAASYSAAYLTGAGTAGSPSDYV
FT                   LESSRRARGFAVWAALRELGETGVADLVARCCALARRFADGLAAGGVEIVNDVVLNQVL
FT                   ADFGSDERTDAVIDAVQREGTCWLGGTTWRGRRLMRISVSNHSTTEDDIDRSVAAVLRL
FT                   AAGL"
     atgaccgacg aaccgggatc cgtcgccgac ctgatccgta cggccgccga ggccgtcatc        60
     gactaccggg ccgggctgcc gcaccgcccg gtcgccggcc cggccgatcg ggcggccctg       120
     ctggccgccc tcggtgggcc gctgccggcc gggccgacgt cgccggaccg ggtgatcgac       180
     gacctcgtcg tcgccgccga tcccggcctg gtggccacgg ccggcccgcg gttcttcggg       240
     ttcgtgatcg gcgggtccct gccggcggcc acggcggcgg acatcctggc cgtcgggtgg       300
     gaccaggtgg cgttcaacgc gatctcctcc cccgccgcga gtgtggtgga ggaggtggcc       360
     ggcggctggt gcaagcagct gctcggaatc ccggcgtcgg cgtccgtcgg cttcggcacc       420
     ggcgcgcagt cggccaacac cgtcgggctg gcgaccgccc ggcaccaggt actggccgcc       480
     gccgggtggg acgtcgagcg agacggtctg gccgggtcgc cccgggtgcg ggtggtcgcg       540
     tcagtggagc ggcacgccac ggtggaccgg tcgttgcggc tgctcggcct gggcaacgcc       600
     agcgttcgac cggtcgccgc cggcccgcag ggggccatcg acatcaatga cctggcaaag       660
     gttctggccg acgagccgac catgccgacg atcgtcgtgc tgcagacggg caacgtcaac       720
     accggcgcct gcgacgacct gcgagccgcg atcgggctgg cccgcacggt cgagcacagc       780
     tgggtgcacg tcgacggcgc cttcggtctc tgggcagcgg cctgcccgca gacccgcgca       840
     ctgaccgacg gcatcgagct ggccgactcg tggtgcaccg acgcgcacaa gtggctcaac       900
     gtgccctacg actgcggcct ggtcttctgc gccgatccgt cggcgcacgt cgcggccgca       960
     tcgtactcgg cggcctacct gaccggggcc ggcacggccg ggtcgccgtc cgactacgtg      1020
     ctcgaatcct cgcgccgagc ccggggtttc gcggtgtggg cggccctgcg cgagctgggt      1080
     gagaccgggg tggccgacct ggtcgcccgg tgctgcgcgc tggcccgccg gttcgccgac      1140
     gggctggccg ccggcggggt cgagatcgtc aacgacgtcg tgctcaacca ggtgctggcc      1200
     gacttcggct ccgacgagcg caccgacgcg gtgatcgacg ccgtgcaacg ggagggcacc      1260
     tgctggctgg gcgggaccac ctggcgtggg cgacggttga tgcgcatctc cgtgtcgaac      1320
     cactccacca ccgaggacga catcgaccgc agcgtcgcgg ccgtcctgcg cctggccgcc      1380
     gggctctga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page