(data stored in ACNUC30630 zone)

EMBL: CP001737.PE174

CP001737.PE174       Location/Qualifiers
FT   CDS_pept        complement(200875..201324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0179"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: xop:PXO_02640
FT                   low molecular weight heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76612"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ25"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACV76612.1"
FT                   /translation="MLGFDPFRDMDRLASRLSNLPVPNGRTPAFMPMDLFRAGDHYILT
FT                   ADLPGVDPGSIDIGIDNNTLTIKAERTARSEDSVQWIASERFTGSFLRQLSLGDGIDTD
FT                   GISASYENGVLTVTIPVADKAKPRRVQIRTGGDRTVVEPQAVAAS"
     gtgcttggct tcgatccgtt ccgtgacatg gaccggctcg cgtcgcgact gtccaatctg        60
     cccgtgccca acggccggac cccggcgttc atgccgatgg atctgttccg ggccggggat       120
     cactacatct tgaccgccga tctgcccggc gtcgacccgg ggtcgatcga catcggtatc       180
     gacaacaaca ctctcaccat caaggccgag cgcaccgctc gctcggagga cagcgtgcag       240
     tggatcgcca gcgaacggtt caccggcagc ttcctgcgcc agctgtcgct gggcgacggg       300
     atcgacacgg acggcatcag cgcgagctac gagaacggcg tgctcaccgt gactattccc       360
     gtggccgaca aggccaagcc gcggcgggtg cagatccgga ccgggggcga ccgcaccgtc       420
     gtcgagcccc aggccgtcgc cgcgagctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page