(data stored in ACNUC30630 zone)

EMBL: CP001737.PE178

CP001737.PE178       Location/Qualifiers
FT   CDS_pept        204944..205978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0183"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: ppf:Pput_3233 alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76616"
FT                   /db_xref="GOA:C8XJ29"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ29"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV76616.1"
FT                   /translation="MATMQDVANLAQCSLSTVSYAINNTRPISAATRQRIEQAMRELDF
FT                   RPNQIARSLASRRSNILALTFPGTENTLGSTIMEFVTGAAQAARERGFHLVVWPYAPAQ
FT                   ADEMLQMSRQGLADGIIVMEVRRDDPRVRLLDEHQFPLTMIGRAEDGTDSRCVDVDFEQ
FT                   TAEAAVAHLAELGHTDIVLLNHSADSRDHGYGPTLRIAEGFHRVMGRRGLTGQVLWCDE
FT                   TPAAGRRAIDELTGRWPAVTAMVAMNEHAVIGAVGGLAGRGIAVPQTFSVLSIVTSPLM
FT                   AQMAEPALTILHSPGADLGRLGVQNLLDQLDGRRPAPAPTLLPCRWEAGRSTGPVPPVI
FT                   HRPR"
     atggccacaa tgcaggacgt cgcgaacctc gcccagtgct cgctgagcac cgtgtcctac        60
     gcgatcaaca acacccgccc gatctcggcg gccacccgtc agcgcatcga acaggccatg       120
     cgcgagttgg acttccggcc gaaccagatc gcccgcagcc tggccagccg gcgcagcaac       180
     atcctggcct tgaccttccc cggaactgag aacaccctgg gcagcaccat catggagttc       240
     gtcaccggcg cggcccaggc cgctcgggag cgcggattcc acctggtggt ctggccctac       300
     gccccggcgc aggccgacga gatgctgcag atgagccgcc agggcctggc cgacgggatc       360
     atcgtgatgg aggtccgccg ggacgatccg cgggtccgcc tgctcgacga gcaccagttc       420
     ccgttgacga tgatcggccg tgccgaagac ggaaccgaca gccgttgtgt cgatgttgat       480
     ttcgagcaga cggcggaagc cgccgtggcc cacctggccg agctggggca caccgacatc       540
     gtcctgctca accactcggc ggacagccgg gaccacggct acgggcccac gctgcggatc       600
     gccgaagggt tccaccgggt gatgggccgg cgtggtctga ccggccaggt cctgtggtgt       660
     gacgagacgc ccgcggccgg ccggcgggct atcgacgaac tgaccggccg ttggccggcg       720
     gtcacggcca tggtggcgat gaacgagcac gccgtgatcg gggcggtggg cgggctcgcc       780
     ggccgcggaa tcgccgtgcc ccaaacgttc tcggtgctgt ccatcgtgac cagcccgctg       840
     atggcccaga tggccgagcc ggccctgacc atcctgcact cacccggtgc cgacctcggc       900
     cggctcggtg tgcagaacct gctcgaccag ctcgacgggc gccggcccgc ccccgcaccc       960
     acgctgttgc cctgtcgatg ggaggcgggc cgcagtaccg ggcccgtccc gccggtcatc      1020
     caccggcctc gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page