(data stored in ACNUC30630 zone)

EMBL: CP001737.PE188

CP001737.PE188       Location/Qualifiers
FT   CDS_pept        218703..220055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0193"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: bja:bll6547 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76626"
FT                   /db_xref="GOA:C8XJ39"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ39"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV76626.1"
FT                   /translation="MTEHNPMTAPLRRIPVRFRWWLAGCLVALVAAFSLLHAFAPGPDV
FT                   PEIMRQPGALLLLALIVLADLHPALPWMRSTNPFDEFIFSTPLAIAALLVFGPHAAIMF
FT                   VIAGFAMTVALGMRWWRVVLNAALWGVQGAAAAGVLAVVWAAAGWDNEVPAEAMIPMTI
FT                   VLAVIIEGLNIALVMTSQCLAGATTPRAYLADWRSQVAIGTLDLTAPIPAALAAAQPAL
FT                   LPLLAVAMVAAQAGLSAVTSRTAQAGTDPLTSVPNRAYLLARIKSRLAGTEDARDPVTV
FT                   LLVDLDRFKQINDELGHLVGDRVLVEVARRLEESTRSSDVVARFGGDEFAVLLSGGSGQ
FT                   RNAQEVAARIRTAVARPIHLDGRSVQVGVTIGWALAEGHDTDPLALLHRADARLYAAKA
FT                   ARSPAPAPLAEPLPARPEASPVTDFRGPIWSGTSVRSSQAHDGDASAATAS"
     atgaccgagc acaatccgat gacggcgccg ctgcgccgga taccggtccg tttccgctgg        60
     tggttggccg gctgcctggt cgcgctggtc gcggcgttct ccttgctgca cgccttcgcc       120
     cccggaccgg atgtcccgga gatcatgcgc caacccgggg cgctgctgct gctggccctg       180
     atcgtgctgg ccgacctgca tcctgcgctg ccgtggatgc ggtccaccaa cccgttcgac       240
     gagttcatct tctccactcc gctggccatc gccgcgctgc tggtgttcgg gccgcacgcc       300
     gcgatcatgt tcgtgatcgc cgggttcgcc atgaccgtgg ccctgggcat gcgttggtgg       360
     cgggtggtgc tcaacgcggc gctctgggga gtgcagggcg ccgcggccgc cggcgtcctg       420
     gccgtggtgt gggccgccgc gggctgggac aacgaggtgc cggccgaggc gatgatcccg       480
     atgacgatcg tgctggccgt gatcatcgag gggctcaaca tcgccctggt gatgacctcg       540
     cagtgcctgg ccggggcgac cacgccccgg gcgtacctgg ccgactggcg cagccaggtc       600
     gccatcggca cgctggatct cacggcgccc attcccgcgg cgctggcggc cgctcagccg       660
     gccctgctgc cgctgctggc ggtggccatg gtggccgcgc aggcgggcct gagcgcggtg       720
     acgtcgcgga cggcccaggc cggcaccgac ccattgacct cggtgcccaa ccgcgcctac       780
     ctgctggccc ggatcaagtc ccggctggcc gggaccgagg atgcccgcga cccggtcacc       840
     gtgctgctcg tcgacttgga ccggttcaag cagatcaacg acgagctcgg ccacctggtc       900
     ggtgaccggg tcctggtcga ggtcgcccgc cggctggagg agtccacccg gtccagcgac       960
     gtcgtcgccc ggttcggcgg cgacgagttc gcggtgctgc tctccggcgg gtccgggcag      1020
     cgcaacgcgc aggaggtggc ggcgcggatc cggaccgcgg tcgcccggcc gatccacctc      1080
     gacgggcggt cggtccaggt cggagtcacc atcggctggg cgctggccga ggggcacgac      1140
     accgatccgt tggcactgct gcaccgggcc gacgcccgcc tgtacgcggc gaaggcggct      1200
     cgcagtcccg cgccggcacc gctcgccgag ccgctcccgg cccgccctga ggcgtcgccg      1260
     gtcaccgact tccgtggacc gatctggtcc ggtacatcgg tgcgctcgtc ccaggcgcat      1320
     gatggggatg cgtcggcggc caccgcttcg tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page