(data stored in ACNUC30630 zone)

EMBL: CP001737.PE19

CP001737.PE19        Location/Qualifiers
FT   CDS_pept        21877..23046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76457"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW6"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3510"
FT                   /protein_id="ACV76457.1"
FT                   /translation="MALTHRQLNRATLARQLLLGRERCGVADAVGRVVALQAQDAASPY
FT                   LALWNRIEAFDPDDLTAAYADHRVLKAPLMRITLHAVRAEDYPAFRRAMISSLRASRVG
FT                   DRRFRGLGIAVEQADALVPDLLTFLREPRTNAEIDGWVRQRCGELPAPGVWWALRTYGP
FT                   FVHAPTGGPWSFGPRPAYRAAPAVPLGRHLGGTDQAGDRTGEQAAIRSLIGRYLDGFGP
FT                   AAIADIAQFTLLRRSVIRDAAATMDDLVAMTGPEGGALLDRPPGPLPDPDTVAPPRLLG
FT                   MWDNVLLAYADRSRLIPPAYRRHVIKQNGDVLPTVLIDGQVAGTWRPVDGRIEIGAFHP
FT                   LTEPDWAALEVEAAALHAMLADREPPIYRRFAHWWVKGLPIEQTRRLAG"
     gtggccctga cccaccgcca gctcaaccgc gccaccctgg cccggcaact gctgctcggc        60
     cgggagcggt gcggcgtcgc cgacgcggtc ggccgggtcg tggcgttgca ggcgcaggac       120
     gccgcctcgc cctacctggc tctgtggaac cggatcgagg ctttcgaccc cgacgatctg       180
     acggctgcgt atgccgacca tcgggtgctc aaggccccgc tgatgcggat caccctgcac       240
     gccgtgcggg ccgaggacta tccggcgttc cggcgggcca tgatcagctc cctgcgcgcc       300
     tcccgcgtcg gcgaccggcg ctttcgcggg ctcggcatcg ccgtggagca ggccgacgcg       360
     ctggtgcccg acttgctgac ctttttgcgc gaaccgcgca ccaacgccga gatcgacggt       420
     tgggtgcggc agcggtgcgg cgagctgccg gcgcccgggg tgtggtgggc gctgcggacc       480
     tacggaccgt tcgtgcatgc cccgaccggc ggcccgtggt cgttcgggcc gcgcccggcg       540
     taccgcgcgg ccccggccgt ccctctcggc cgtcatctcg gcggaaccga tcaggccggc       600
     gatcgcaccg gtgaacaagc cgcgatccgg tcgctgatcg gccgttatct ggacggtttc       660
     ggaccggccg cgatcgccga catcgcccag ttcacgctgc tgcggcgcag cgtcatccgg       720
     gacgcggcgg ccaccatgga cgacctggtg gcgatgaccg ggcccgaggg cggtgcgctg       780
     ctggaccggc cgccgggccc gctcccggat cccgacaccg tggccccgcc gcgcctgctg       840
     ggcatgtggg acaacgtgtt gttggcctac gccgaccgca gccgcctgat cccgccggcc       900
     taccggcgcc acgtgatcaa acagaacggt gatgtgttgc ctaccgtgct gatcgacggt       960
     caggtcgccg ggacctggcg gccggtcgac ggccggatcg agatcggagc cttccacccg      1020
     ctgaccgaac cggactgggc cgccctggag gtcgaggccg ccgccctgca cgcgatgctg      1080
     gccgaccgcg aaccgccgat ctaccggcgc ttcgcgcact ggtgggtcaa gggtctgccg      1140
     atcgagcaga cccgccgatt ggccggatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page