(data stored in ACNUC30630 zone)

EMBL: CP001737.PE191

CP001737.PE191       Location/Qualifiers
FT   CDS_pept        221942..222895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mno:Mnod_6760 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76629"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76629.1"
FT                   /translation="MNQKGTPGGGGAANRWRSIGLPDQIGRRAIVTGANTGLGFAAAKA
FT                   LAGAGADVVLAVRDLDRGVAAAQRIRDALDEAKVRVVHLDLARLASVADFAATQCAQGP
FT                   VDILINNAGLMLVPRREFTADGFEAQMGVNHLGHYALVAGLLPALEQAPAARIVGVTSL
FT                   AARRARRLDQRLGLDGDYRPMGAYSQSKLAVGLFAVELDRRLQAAGSRARSLLAHPGWS
FT                   ATAVAQPEDGAGRKVVFSRRATALLGSSPASGARSEVAAATFPDLPGGSLVGPHFLVRG
FT                   APRARPAPKAMTDPAQAGWLWSRSAELTGVEPLPGS"
     gtgaaccaga aggggacgcc ggggggcggc ggcgcggcga atcgctggcg cagcatcggc        60
     ctgccggacc agatcggccg gcgggccatc gtcaccgggg ccaacacggg gctgggcttc       120
     gccgccgcga aggcgctcgc cggggccggc gcggacgtcg tgctggcggt gcgcgacctg       180
     gaccgcgggg tggcggccgc ccagcggatc cgggatgcgc tggacgaggc caaggtccgc       240
     gtcgtgcacc tggacctggc cagactggcc tcggtcgccg atttcgcggc cacccagtgc       300
     gcgcagggtc cggtcgacat cctgatcaac aacgccgggc tgatgctggt gccgcgccgc       360
     gaattcaccg cggacgggtt cgaggcccag atgggcgtca atcacctggg ccactacgcg       420
     ctggtcgccg ggctgctgcc ggcgctggag caggccccgg cggcgcggat cgtcggagtc       480
     acctcgctgg ccgcgcgccg cgcccggcgg ctggaccagc ggctcggtct ggatggcgac       540
     taccgcccga tgggggccta cagccagtcg aagctggccg tcgggctgtt cgccgtggaa       600
     ctggaccggc gacttcaggc ggccggttcc cgggcacgct cgctgctggc ccaccccggc       660
     tggtcggcca ccgcggtggc ccagcccgag gacggagccg gccggaaggt cgtgttctcc       720
     cggcgggcca cggcgctgtt gggcagctcg ccggcctccg gtgcccggtc cgaagtggcc       780
     gcggcgacct tcccggatct gccgggcggt tcgctggtcg ggccccactt cctggtccgc       840
     ggcgcgccca gggcgcgtcc ggcacccaaa gcgatgaccg atccggctca ggccggctgg       900
     ctgtggtcgc ggtcggccga gctgaccggg gtggaaccgc tccccggctc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page