(data stored in ACNUC30630 zone)

EMBL: CP001737.PE196

CP001737.PE196       Location/Qualifiers
FT   CDS_pept        225775..226728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0201"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: mxa:MXAN_7405
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76634"
FT                   /db_xref="GOA:C8XJV1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV1"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ACV76634.1"
FT                   /translation="MFLLRKPILALSGNTAVRDALTSTSLTASVVDRFIAGETTADAVA
FT                   AVSRLRPDGLQVSLDHLGEDTTDRATADATVEAYLQLIEALAAAGQVAGAELSVKLSAV
FT                   GQALIASPDLPAGGNAYALAGARRITDAAYAAGARVNLDMEDHTTVDQTLEVLFELRRA
FT                   HPDVGVAIQAMLLRTPKDLAELTGPGSRVRLVKGAYHEPAEVAYTDPAQIDLAYVRAMK
FT                   LLMHGKGYPMIASHDPRLVAIADRLAADAGRSPDRWEHQMLYGIRPDEQRRLVAAGKQV
FT                   RVYVPYGSDWYGYFTRRLAERPANLLFFLRSLTSKG"
     atgttcctgt tgcgcaagcc gatcctggcc ctgtccggca acaccgcggt gcgggacgcc        60
     ctgaccagca cctcgctgac ggcttcggtg gtggaccggt tcatcgccgg ggagaccacc       120
     gcggacgcgg tggccgcggt cagccggctc cgtcccgacg ggctgcaggt cagcctcgat       180
     catctgggcg aggacaccac cgaccgggcg acggcggatg ccaccgtcga ggcgtacctg       240
     cagctcatcg aggcgctggc cgcggccggt caggtggccg gagccgagtt gtcggtcaag       300
     ctctcggccg tcgggcaggc cctgatcgcc tccccggacc tgccggccgg tgggaacgcc       360
     tacgccctgg ccggggccag gcggatcacc gacgccgcct acgccgccgg tgcccgggtg       420
     aacctggaca tggaggacca caccacggtc gaccagaccc tggaggtgct cttcgaactt       480
     cgccgggccc accccgacgt gggtgtcgcc atccaggcga tgctcctgcg caccccgaag       540
     gatctggccg agctgaccgg gcccggatcg cgggtccgcc tggtcaaggg ggcctaccac       600
     gagccggccg aggtcgccta caccgatccg gcgcagatcg acctggccta cgtgcgggcg       660
     atgaagctgc tcatgcacgg caagggttac ccgatgatcg cctcccacga cccccggctg       720
     gtggcgatcg ccgaccggtt ggccgccgac gccggccgga gtccggaccg ttgggagcac       780
     cagatgctct atgggatccg gccggacgag caacgccggc tggtcgccgc cggcaagcag       840
     gtgcgggtgt acgtgcccta cggctcggac tggtacggct acttcacccg gcggctggcc       900
     gagcgcccgg ccaacctgct gttcttcctg cgctcgttga cctccaaggg ttga             954
//

If you have problems or comments...

PBIL Back to PBIL home page