(data stored in ACNUC30630 zone)

EMBL: CP001737.PE199

CP001737.PE199       Location/Qualifiers
FT   CDS_pept        complement(230484..232619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0204"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   afw:Anae109_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76637"
FT                   /db_xref="GOA:C8XJV4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV4"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACV76637.1"
FT                   /translation="MPIPESPAFSAVIFDRRDPAQSQEIDRLIASGITLRDAVVPTDDL
FT                   RRLRPALTDDELDEPPRWAYFAWQHSIVRILGPGLYRRVRLDRNRIKITGDEQERLSSR
FT                   RIGIAGLSSGYSIALALVLEGLCGHLRLADFDTLELSNLNRVPLGLFEVGVNKAVAAAR
FT                   RISELDPYLSLEVLTDGVTATNADEFIDGLDMLLEQCDSFDMKVVLRDSARRQRVPVVM
FT                   QTNDRGLLDVERFDLEPDRPLFHGLVDVDALTDVAELTPEQKTPLLLKIIDARQMSDRG
FT                   AASLIELGRTVGQWPQLGSETLFGAAMVAAVARRIGLGRPLPSGRLRTDPDDLLALLAE
FT                   PTPDPVPPGPAAPAELRPDADPLTTILHAASRAPSGGNTQPWRFRAGAARLIIEPAPTP
FT                   SRMDVAGRGSLVAAGAAAFNARVAAAARGTLGPWHIHADQSPVNVEIDLTEGGFDPDLA
FT                   ALYQPMVARTANRSPGRRRELAAPVVAALTAAAAAEGAVLRLISDLPRLRALGEVLGEA
FT                   DRIRFLSGGLRQDMLDELSRPGLDRPDIGIDVRTLGLGAATSLLDLVARPPVMQTLRSL
FT                   SGGSMFRDMTAARVTSASAVGVVVIDGDRVEDYVRGGAAMERVWIAATTAGLGVVPLSP
FT                   AFLYARTPADLATLAPDSTGELADLQGRMNEIVGIAESQAPVLIMRFVHDPQEAPRSLR
FT                   RPLSEVVISSENTVGTN"
     atgcccatcc ccgaatcgcc ggcattctcg gccgtcattt tcgatcgccg ggatccggcg        60
     caatcgcagg agatcgaccg gctcatcgcc tccggcatca ccctgcgtga cgcggtggtc       120
     ccgaccgatg atcttcgccg gctccggcct gcgctcaccg acgacgagct cgacgagccg       180
     ccgcggtggg cctactttgc ctggcaacac tcgatcgtgc ggatcctcgg acccgggctg       240
     taccggcgag ttcggttgga ccgcaaccgg atcaagatca ccggtgacga gcaggagcgg       300
     ttgtcctcgc ggcgcatcgg gatcgccggg ctgagttcgg gctattcgat cgcgctggcg       360
     ctggtcctcg agggattgtg tggccacttg cggttggccg acttcgacac cctcgagctg       420
     tccaatctca atcgcgtccc gctcgggctt ttcgaagtgg gcgtgaacaa ggccgtggcc       480
     gccgcccgcc ggatttccga actcgatccg tacctgtccc tggaagtgct gaccgacggt       540
     gtcacggcca ccaacgccga tgaattcatc gacggactcg atatgctcct ggagcagtgt       600
     gattcatttg acatgaaagt cgtgctacgg gactcggcgc gccgacaacg ggtcccggtc       660
     gtgatgcaga ccaacgatcg cggactgctc gatgtcgagc gtttcgatct cgagccggac       720
     cgcccgctct ttcacggact ggtcgacgtg gatgcgctga ccgacgtggc cgagttgacc       780
     cccgagcaga agacaccgtt gctgctcaag atcatcgatg cccggcagat gtccgatcgc       840
     ggcgcggcct cgctcatcga gctcggacgg accgtcgggc aatggccgca gctgggcagc       900
     gagaccctgt tcggcgcagc gatggtggcc gcggtggccc gccggatcgg cctgggccgg       960
     ccgctcccgt ccggccggct gcgcaccgac cccgatgatc tgctggcgct gctggccgaa      1020
     cccacgcccg atccggtgcc gcccggtccg gccgcgccgg cggagcttcg gcccgatgcc      1080
     gatccgctga ccacgatcct gcatgcggcg agccgggccc cgtccggcgg caacacccag      1140
     ccctggcgat tccgggccgg cgcggcgcgc ctgatcatcg agccggcccc gacccccagc      1200
     cggatggacg ttgccggccg cggcagcctg gtcgcggccg gcgccgccgc cttcaacgcc      1260
     cgggtcgcgg cggccgcgcg aggcaccctg ggaccgtggc acattcacgc cgaccagtcg      1320
     cccgtcaacg tcgagatcga tttgactgaa ggcggtttcg atcccgacct ggcggcgctg      1380
     taccagccca tggtggcccg gacggcgaat cgcagcccgg gccggcggcg cgagctggcg      1440
     gccccggtgg tcgccgcgct cacggctgcg gccgccgccg agggcgccgt cctgcggttg      1500
     atcagtgatc tgccgcgcct acgcgcgctc ggcgaggtac tcggcgaggc cgaccggatc      1560
     cgtttcctca gcggcggtct gcggcaggac atgctcgacg agctcagccg gcccggactc      1620
     gaccgccccg acatcggtat cgacgtccgg accctgggcc tgggcgcggc gaccagcctg      1680
     ctcgacctgg tcgcccgccc gccggtgatg cagaccctgc gcagcctgtc cggtgggtcg      1740
     atgttccgtg acatgaccgc tgcccgagtg acctcggcct cggccgtcgg cgtggtcgtc      1800
     atcgacggcg atcgggtcga ggactacgtg cgcgggggcg cggcgatgga gcgcgtctgg      1860
     atcgccgcga ccaccgcggg tctgggcgtg gtgccgctga gcccggcctt cctgtacgcc      1920
     cgcacccccg ctgacctggc caccctggcg ccggattcaa ccggcgagtt ggcggatttg      1980
     cagggcagaa tgaacgagat cgtcggcatt gcggaaagcc aggctcccgt gctgatcatg      2040
     cgcttcgtgc acgatccgca ggaagcgccg cggagcctac gtcgacccct gtcggaagtc      2100
     gtgatttcat cggagaatac tgtcgggacc aactga                                2136
//

If you have problems or comments...

PBIL Back to PBIL home page