(data stored in ACNUC30630 zone)

EMBL: CP001737.PE2

CP001737.PE2         Location/Qualifiers
FT   CDS_pept        2436..3662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppf:Pput_0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76440"
FT                   /db_xref="GOA:C8XHU9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHU9"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACV76440.1"
FT                   /translation="MKFRVARDDLADAVAWVAKSLPARPPVPVLGGILLEVSGSTLTVA
FT                   GFDYEVSTRATLTVDTLDELEPDAPGGPAGTDRVLVSGRLLAEITRSLPAKPVDLAVLG
FT                   PKVSIVAGSARFTLPTMPVEDYPPLPQMPAASGTVDSAEFAEAVAQTAIAAGRDDTLPM
FT                   LTGIRVEIDGDRLTLAATDRFRLAVRELGWHPDQENLSTAVLVPARTLADAAKTLGGAK
FT                   QVTVALGEGLLGLDAGDRRTTVRLLDVEFVKYRSLLPTSHTTTVEVPVAALGESIKRVA
FT                   LVTDRGHHLRLQVGEGALTLTAGGDDEGRAEEDLPAEVDGEELLIAFNPSYLLDGLGVV
FT                   HADTVRLSFTTPARPALLVPIVKSDEPAESAEAAAEAAATPDIDADGVGSDEDTPAYRY
FT                   LVMPARLPG"
     atgaagttcc gcgtcgcccg cgacgatctc gccgacgccg tcgcctgggt cgccaagtcg        60
     ttgccggctc gtccgccggt tccggtgctc ggcgggatcc tgctcgaggt cagcggctcg       120
     accctgaccg tggccggctt cgactacgag gtctccaccc gggccaccct caccgtggac       180
     accctggacg aactagaacc ggacgccccc ggcggcccgg ccggcaccga ccgggtgctg       240
     gtctccggcc ggctgctcgc cgagatcacc cgctccctgc cggccaagcc ggtcgacctg       300
     gccgtgctcg gccccaaggt cagcatcgtg gccgggtccg cccggttcac cctgccgacc       360
     atgccggtcg aggactaccc gccgttgccg cagatgccgg ccgcctccgg caccgtggac       420
     agcgccgaat tcgccgaggc cgtcgcccag accgcgatcg ccgccggtcg cgacgacacc       480
     ctgccgatgc tgaccgggat ccgggtcgag atcgacggcg accggttgac cctggccgcc       540
     accgaccggt tccggctggc cgtgcgtgag ctgggctggc acccggacca ggagaacctc       600
     tcgaccgccg tgctggtacc ggcccgcacc ctggccgacg cggccaagac gctgggcgga       660
     gccaagcagg tgacggtcgc gctcggcgag gggctgctcg gcctggacgc cggcgatcgg       720
     cgtaccaccg tgcgcctgct ggacgtcgag ttcgtcaagt accgctcgct gctgccgacc       780
     tcgcacacca ccaccgtcga ggtgccggtc gcggccctcg gcgagtcgat caagcgggtc       840
     gccctggtca ccgaccgcgg tcatcaccta cggctgcagg tcggcgaagg ggcgctgacg       900
     ctgaccgccg gcggcgacga cgagggtcgc gccgaggaag acctgccggc cgaggtggac       960
     ggcgaggaac tgctcatcgc gttcaacccg tcgtacctgc tggacggcct gggcgtggtg      1020
     cacgccgaca cggtccggct ctcgttcacc accccggccc gcccggcgct gctggtgccg      1080
     atcgtcaaat cggacgagcc ggccgaatca gccgaggccg cggccgaggc cgcggcgacg      1140
     ccggacatcg acgccgatgg ggtcggctcc gacgaggaca ctccggccta tcgctacctg      1200
     gtgatgcccg cccgcctgcc cggctga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page