(data stored in ACNUC30630 zone)

EMBL: CP001737.PE20

CP001737.PE20        Location/Qualifiers
FT   CDS_pept        23132..25150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_0790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76458"
FT                   /db_xref="InterPro:IPR027787"
FT                   /db_xref="InterPro:IPR027788"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW7"
FT                   /inference="similar to AA sequence:KEGG:M446_0790"
FT                   /protein_id="ACV76458.1"
FT                   /translation="MGLQQWAAKLAGPGDQTGLLVAAAIAPGTFEPSLVPRSLPDQAIV
FT                   TGIGTTLSYVLTVATQDSIEALASGLAGRVGRGSAPTRQRRAALLIDLAVIPVGLAAAG
FT                   ALRRRPQESTLRGVARQVAWRTGVTGLGASLFTLTELGLTAADGALGAGGRIARIPLGA
FT                   PVGLGVGLALEAYRRRGLPAEPVTTDAPATEPLRAAVASVGVVGIVSVGALAQRLLADG
FT                   TAALLAGVLPGGRVVWRPMGHVLTLAAVAGAGTVLWHRAIRSIEAGTNVIEPIIDDEGG
FT                   RRWVGEHASGSANSLIPWATLGREGRRHVLLYPRPQPVRDLPVSLPDLAISSVMGEPAA
FT                   AEPALVYVGLDSAPTAQARVDLALAEMDRVGAWDRSLIMLCSPTGSGYLNYCATAAASY
FT                   LTRGDLAIVTMQYSKRPSPLSLFKVKDAREQNRLLWLAISARLRERSGPRPRAVLFGES
FT                   LGAHTSQDVLLHWGTLGPQALGIDRALWIGTPYGSGWMHQVTGEPRPDVDPNLVAMVND
FT                   FEQLQALPESHRATLRYVMVSHDNDGVTKFGADLLTRRPAWLTDARPAVQIVPGASPRG
FT                   IPARLRWRPITSFLHGLMDMKNAQKMQGYRAWAHDYRPDIARFVAQVYDLPATPAQLAR
FT                   IETALQAREEIRDRLLSQHLDAMTPSPDRFVPPAPER"
     atgggactgc agcagtgggc ggccaagctg gccgggccgg gcgatcagac cggcctgctg        60
     gtcgcggcgg ccatcgcgcc gggcacgttc gagccgtccc tggtcccgcg cagcctgccg       120
     gaccaggcga tcgtcaccgg tatcggcacc acgctgtcct acgtcctgac cgtcgccacc       180
     caggacagca tcgaggcgtt ggcctcgggc ctggccggcc gggtgggtcg cggcagcgcg       240
     cccacccggc agcggcgggc cgcgctgctg atcgacctgg ccgtcatccc tgtcgggctg       300
     gccgccgccg gggcgctgcg ccgccggccg caggagtcca ccctgcgcgg ggtggcccgg       360
     caggtcgcct ggcggaccgg cgtcaccggc ctgggcgcga gcctgttcac cctgaccgaa       420
     ctgggcctga ccgccgcgga cggcgcgctg ggcgccggcg gccggatcgc ccggatcccg       480
     ctcggtgcgc cggtcggtct cggtgtcggg ctggccctgg aggcctaccg gcggcgcggc       540
     ctgccggccg agccggtcac caccgacgcg ccggcgaccg agccgctgcg ggcggcggtg       600
     gccagcgtgg gcgtggtcgg gatcgtctcg gtcggcgcgc tggcccaacg gctgctggcc       660
     gacggcaccg ccgccctgct ggccggcgtg ctgccgggcg gccgggtggt gtggcggccg       720
     atgggacacg tgctgaccct ggccgcggtg gccggggcgg gcaccgtcct gtggcaccgg       780
     gcgatccggt cgatcgaggc cggcaccaac gtgatcgagc cgatcatcga cgacgagggc       840
     ggccggcgat gggtcggcga gcacgccagc gggtcggcca acagcctcat cccgtgggcc       900
     acgctcggcc gcgagggtcg ccggcacgtg ctgctctacc cgcggccgca gccggtccgg       960
     gacctgccgg tgagcctgcc cgacctggcc atcagctcgg tgatgggcga gccggccgcc      1020
     gccgaaccgg ccctggtcta cgtcgggctg gacagtgcgc cgaccgccca ggcccgggtc      1080
     gacctggccc tggccgagat ggatcgggtc ggcgcctggg accggtcgct gatcatgctc      1140
     tgctcgccca ccggctcggg ctacctgaac tactgcgcga ccgccgcggc gtcctacctc      1200
     acccgcggcg acctggccat cgtgacgatg cagtactcca agcggccgtc gccgctgtcg      1260
     ctgttcaagg tcaaggatgc ccgcgagcag aaccggttgc tctggctggc gatcagcgcc      1320
     cggctgcggg agcggtccgg tccccgaccc cgggcggtgc tcttcgggga gagcctgggt      1380
     gctcacacca gccaggacgt gctgctgcac tggggcaccc tgggaccgca ggccctgggc      1440
     atcgatcggg cgttgtggat cggcacgccg tacggcagcg gctggatgca ccaggtgacc      1500
     ggcgaacccc gacccgacgt cgacccgaac ctggtcgcca tggtgaacga cttcgagcag      1560
     ctgcaggcgc tgcccgagag ccatcgggcc accctgcggt atgtgatggt cagtcacgac      1620
     aacgacggcg tgaccaagtt cggcgccgac ctgctcaccc gccgcccggc ctggctcacc      1680
     gacgcgcggc cggcggtgca gatcgtgccc ggggccagcc cccgcgggat tccggcccgg      1740
     ctgcgatggc ggccgatcac ctcgttcctg cacgggctga tggacatgaa gaacgcccag      1800
     aagatgcagg gttaccgggc ctgggcccac gactaccgtc ccgacatcgc ccgattcgtc      1860
     gcgcaggtct acgacctgcc ggccaccccg gcgcagctcg cgcggatcga gaccgcgctg      1920
     caggcccgcg aggagatccg ggaccggctg ctctcccagc atctggacgc gatgacccca      1980
     tcccccgatc ggttcgttcc tccggcgccc gagcgatga                             2019
//

If you have problems or comments...

PBIL Back to PBIL home page