(data stored in ACNUC30630 zone)

EMBL: CP001737.PE201

CP001737.PE201       Location/Qualifiers
FT   CDS_pept        233751..234710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0206"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="TIGRFAM: L-lactate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: scl:sce5245 L-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76639"
FT                   /db_xref="GOA:C8XJV6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV6"
FT                   /inference="protein motif:TFAM:TIGR01771"
FT                   /protein_id="ACV76639.1"
FT                   /translation="MTDISLRRNKVAIVGAGSVGATLAYASLIRGVAHDVVLYDMAKAK
FT                   VEAEVLDLRHGLQFCPPADVDGSDDVAICANADVIAITAGAKQKPGQTRLELAGINVDI
FT                   CRKLIPALLDVAPDAVIVMVTNPVDVLTYAALKFSGLPKNRVLGSGTVLDSARLRQVIA
FT                   RKLNVASQSVHAFIAGEHGDSEFPLWSSASIGTVPVLDFAAPDGTTLDEEQEAQIAHDV
FT                   VNAAYSIILGKGATNYAVGLAGARVLEAILRDENGVLPVSSLLDGFHGITDVCLSLPSL
FT                   VNKSGVASMLDVPLSDREVEQLKASAAEVKSVQASLGL"
     atgacggaca tctcgctacg ccggaacaag gtcgccatcg tcggggccgg atcggtggga        60
     gccacccttg cctatgcgtc gctgatccgc ggcgtcgccc acgacgtcgt gctctacgac       120
     atggccaagg ccaaggtcga ggccgaggtg ctcgacctgc ggcacgggct gcagttttgc       180
     ccgccggccg acgtcgacgg ctccgacgac gtcgccatct gcgcgaacgc cgacgtgatc       240
     gccatcaccg cgggggccaa gcagaagccc ggccagaccc ggctcgagct ggccggcatc       300
     aacgtcgaca tctgccgcaa actgatcccc gccctgctgg acgtcgcgcc ggacgcggtc       360
     atcgtgatgg tcaccaaccc ggtcgacgtg ctgacctacg ccgcgctgaa gttctccggc       420
     ctgcccaaga accgggtgct gggcagcggc accgtgctgg actcggcccg gctgcgccag       480
     gtcatcgccc gcaagctcaa cgtcgcctcg cagagcgtgc atgccttcat cgccggcgag       540
     cacggcgact cggagttccc gttgtggagc agcgcgagca tcggcaccgt gcccgtgctc       600
     gacttcgccg cccccgacgg gaccaccctg gacgaggagc aggaagccca gatcgcccac       660
     gacgtggtca acgcggccta ctcgatcatc ctgggcaagg gcgccaccaa ctacgcggtc       720
     ggcctggccg gcgcccgggt gctcgaggcg atcctgcgcg acgagaacgg cgtcctgccg       780
     gtgtcctccc tgctggacgg gttccacggg atcaccgatg tgtgtttgtc cctgccctcg       840
     ctggtgaaca agtcgggcgt tgcgtcgatg ctcgacgtcc cgctgtccga ccgcgaggtc       900
     gagcagctca aggcgtcggc ggccgaggtc aagtcggtgc aggcgtccct gggtctgtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page