(data stored in ACNUC30630 zone)

EMBL: CP001737.PE211

CP001737.PE211       Location/Qualifiers
FT   CDS_pept        complement(244163..244996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0216"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   dal:Dalk_0566 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76649"
FT                   /db_xref="GOA:C8XJW6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACV76649.1"
FT                   /translation="MTSGAPPNPPPPASIPPGSDPDGFLAARPYTARSLWVELVVVFLI
FT                   TLGTSGLSSLVSLIDSLLAAAPLSSQSVAIVVPQAQASLLDLARQVILIVRGFAWGGLG
FT                   LYLLWRSGVNLRARLGLDLRRPWSDLGVGVVLTAVIGIPGIALYLSAVAIGINLTVAPS
FT                   TLNDVWWRLPVLIGAAIENGFLEEVLVVGYLITRLEQLKLPGWAAIGISAGLRGSYHLY
FT                   QGFGGFLGNAVMGVVFAWWFRRTRRLWPLIIAHSLLDIFSFAGYALLKGSVSWLP"
     atgaccagcg gagccccgcc gaacccgccc ccacctgcat cgataccgcc cgggtcggac        60
     ccggacggat tcctcgcagc ccgaccgtac accgcccgct ccctgtgggt ggaactggtc       120
     gtcgtgttcc tgatcacgct gggcaccagc gggctgtcct cgttggtcag cctgatcgat       180
     tcgctgctgg ccgcggcgcc gctgtcctca cagagcgtgg ccatcgtggt gccgcaggcg       240
     caggcgtccc tgctggacct ggcccggcag gtgatcctga tcgtccgcgg cttcgcctgg       300
     ggcgggctgg gcctgtacct gctgtggcgc agcggggtga acctgcgtgc gcggctgggc       360
     ctggacctgc gtcgaccctg gtcggacctg ggcgtcgggg tggtgctgac cgcggtgatc       420
     ggcatccccg gcatcgcgtt gtacctgtcg gcggtggcca tcggcatcaa tctgaccgtc       480
     gccccctcga cgctcaacga cgtctggtgg cggctgcccg tgctgatcgg cgcggccatc       540
     gagaacggct tcctggaaga ggttctcgtc gtcggctacc tgatcacccg gctggaacaa       600
     ctcaagctgc cgggctgggc ggcgatcggc atctccgcgg gtctgcgcgg gtcgtaccac       660
     ctctaccagg ggttcggcgg attcctgggc aatgcggtga tgggtgtggt gttcgcctgg       720
     tggttccgcc gcacccgacg gctgtggccg ctgatcatcg cccactcgct gctggacatc       780
     ttctccttcg ccggttacgc cctgctcaag ggcagcgtga gctggctacc ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page